KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c07620Help
Entry
OCA5_c07620       CDS       T01617                                 

Definition
peptidase M20 family protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ocg01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ocg00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
810422..811642
Genome map
AA seq 406 aa AA seqDB search
MAMTEEQTFLDKIDAEISAERDNLIAFCGRLVREPSESPPGETLGVSKVVQAYLGEHGVA
SEVVACDPNAPNLVAHLGEGAGRHIVYNAHMDTMRPGDESCWSVPILELTRKDGRLYGLG
MGNMKGGLAAMCLATAVLARHRKELPGRLTMTAVCDEVMFGDRGAVHLLAARPDVHGDYM
ISGEGPGFMNMAPAEKGLLWLDVETTGDGGHSSRAMNGETAVGKLVALLTKADALNDVYA
EIPAEINGVTGGPENTGLRLSFSAGVVRADGVRSLIATSARAEIDVRLPPGITGKEIEQR
VRALGSTDGISVRAVKGWDASWTSLSNPVVTEMMAAATTVRGARPDMVVRLPGSDARRWR
DLGVPSVCYGPQPTLSAGVDDYAEEQAVLDCARVYARAALRLMKHG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgacggaggagcaaacctttctcgacaagatcgacgcggaaatttccgcggag
cgtgacaacctgatcgcgttctgcggccggctggtgcgcgagccgagcgaaagcccaccc
ggcgagacgctcggtgtctccaaggtggtgcaggcgtatcttggcgaacacggcgtcgcg
tccgaggtggtcgcgtgcgatccgaatgcgccgaatctcgtggcgcatctcggcgagggg
gcaggacgacatatcgtctacaacgcgcatatggatacgatgcgccccggcgatgaaagc
tgctggagcgtgccgatccttgagctgacgcggaaggatggccgcctttacgggctcggc
atgggcaatatgaaaggcggcctggccgcgatgtgcctcgccaccgccgttctcgcgcgg
catcgcaaggaactgcccggccgtctgacgatgacggccgtctgcgacgaggtgatgttc
ggcgaccgtggtgcggtgcatcttcttgctgcgcgccccgatgtgcatggcgattacatg
atcagcggcgaagggccggggttcatgaacatggcgcccgccgagaaggggctgctgtgg
ctcgatgtcgagaccacgggtgatggcggtcattcctcgcgcgcgatgaatggcgagacg
gcggtcggcaagctcgtggcgctgctcaccaaggccgatgcgctgaacgatgtctatgcc
gaaattcccgccgagattaatggcgtgacgggtgggccggagaatactggcctgcggttg
tcgttcagcgcgggcgtcgtgcgtgccgatggcgtgcgcagccttatcgccacctcggcg
cgggccgagatcgatgtgcgtttgccgcccggcatcactgggaaggagatcgagcagcgc
gtgcgcgcactcggctccacggatggcatcagcgtgcgcgcggtgaaaggctgggacgca
agctggacctcgttgtccaatccggtcgtcacggagatgatggcggctgccaccacggtg
cggggcgcgcggcccgatatggtcgtgcgtctgccgggcagcgatgcacggcgctggcgc
gacctcggcgtgccgtccgtctgttacggtccgcagccgacgctctcggctggtgtcgac
gattacgccgaggagcaagcggtgcttgactgcgcccgcgtctacgcgcgcgccgcgttg
cggctgatgaagcacggatag

DBGET integrated database retrieval system