KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c08150Help
Entry
OCA5_c08150       CDS       T01617                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OCA5_c08150 (ruvA)
Enzymes [BR:ocg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OCA5_c08150 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
865520..866137
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGVIDSYGEDYVILDVQGVGYLVHCATRTLQALPSSGEAAVLSIETYVREDQIKL
FGFRSDIEREWFRLLQTVQGVGAKVALAVLSTLPPSDLANAIALRDKAAVARTPGVGPKV
AERIVTELKDKAPAFANVDPAVVHLAGAVDDDRAPRPVKDAISALVNLGYGQPQAAAAIA
SVARDAGEGAETAQLIRLGLKELAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtaagctcaaaggcgtgatcgattcctacggcgaggattacgtcattctcgac
gtgcaaggcgtcggctatctcgtgcattgcgccacgcgcacgctgcaggcgttgccctcg
tccggcgaggcggcggtgctgtcgatcgagacctatgtgcgcgaggaccagatcaagctg
ttcggttttcgcagcgacatcgaacgcgaatggtttcgcctgttgcagaccgtgcagggc
gttggtgcgaaagtcgcgctcgcggtgctctcgacattgccgccgtccgatctcgccaac
gcgatcgcgctgcgcgacaaggccgcagtggcgcgcacgccgggcgtcgggccgaaggtt
gccgagcgcatcgtcaccgagttgaaggacaaggcgcctgcattcgcgaatgtcgatccg
gcggtggtgcatcttgccggcgcggttgatgatgatcgcgcgccgcgcccggtgaaggac
gcgatctccgcgctggtcaatctcggctacggccagccgcaggcggcggcggcgattgcg
agcgtggcgcgtgacgcgggcgagggcgcggagacggcgcaactcatccggctcgggctg
aaggaactggcgaagtga

DBGET integrated database retrieval system