KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c09870Help
Entry
OCA5_c09870       CDS       T01617                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase 1 (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ocg02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ocg02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1045802..1046968
Genome map
AA seq 388 aa AA seqDB search
MSIDLAAASRPVSQSGDRIQIMVVDDSAIIRGIISRWIEAEADMTVAVTCRTGLDAVNQI
DRIKPDVVILDIEMPDMDGITALPLLLAKKRDLVVIMASTLTLRNAEISLKALSLGAADY
IPKPESNHLGGADAFKHDLVQKIRHLSARLRRRRVASPPLVPAAPATSAVAAAPAAVMAP
PSAVKFPLRAFNKVKPRALLIGSSTGGPQALTVLATELGPIVDKVPVLITQHMPPTFTTI
LAQHVGRASGRPTQEGVDGQIVSPGNIYIAPGGLHMRVKTQGVNTVIALDDGPQINFCRP
AVDPLFTSAIEIWRSDVLAVILTGMGSDGTRGGKEIVAAGGNVIAQDEATSVVWGMPGSA
AQAGICAAVLPLNQIGQKLQRVFSGDFS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgatctggcagccgcctcccgaccggtttcgcaaagcggcgaccgcatccag
attatggtggtggacgactccgccatcatccgtggcatcatttcgcgctggatcgaagcc
gaggccgatatgacggtggcggtgacctgccgcaccggcctcgacgccgtcaatcagatc
gatcgcatcaagcccgatgtcgtgatcctcgacatcgagatgccggacatggacggcatc
accgcgctgccgctgctgctggcaaagaagcgtgacctcgtcgtcatcatggcttcgacg
ctgacgctgcggaatgccgagatcagcctcaaggcgctctcgctcggcgcggccgactac
atccccaaacccgagagtaaccatctcggcggcgcggatgcgttcaagcacgatctcgtg
cagaagatccgtcacctcagcgcgcgcctccggcgccgccgcgtggcgagcccgcctttg
gtcccggccgctcctgcgacgtccgcagtggccgctgcgcctgctgccgtcatggcgccg
ccgtccgcggtcaaattcccgctacgcgccttcaataaggtgaagccccgcgctctcctg
atcggttcgtcgacgggcgggccgcaggcgctgacggtgctcgccaccgagcttggtccg
atcgtcgacaaggtgccggtgctcatcacccagcacatgccgccgaccttcaccaccatt
ctcgcccagcatgtcggccgtgccagcggccgcccgacgcaggaaggcgtcgatggtcag
atcgtcagccccggcaacatttatatcgctccgggcgggctgcacatgcgcgtcaagacc
cagggcgtcaacaccgtcatcgcgctcgatgatggtccgcagatcaatttctgccgcccc
gcggtcgacccgctgttcacctcggcgatcgagatctggcgctccgacgtgcttgccgtg
atcctcaccggcatgggttcggacggcacgcgcggcggcaaggagatcgtcgccgccggc
ggcaatgtgatcgcgcaggacgaggcgacctccgtcgtatggggcatgccgggatcggcc
gcacaggccggcatctgcgccgccgtgctgccgctcaaccagatcggccaaaaactgcaa
agagtgttctcgggagatttttcgtga

DBGET integrated database retrieval system