KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c10350Help
Entry
OCA5_c10350       CDS       T01617                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase MalQ (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCA5_c10350 (malQ)
Enzymes [BR:ocg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OCA5_c10350 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1107335..1109275
Genome map
AA seq 646 aa AA seqDB search
MDLPEKMSRYGIETSFIDGKGHTHTIDEQTFHRIADALGPTPAGPAPVIFRTVNGVEKND
LVARLSHLPAWRVCDANGDVLASEMDGVSGESDLPFGVYRLQDSDAGERSLIIAPEHAYE
GAFDRRWILSVQLYGVRSERNWGIGDFSDLQTLLRWSATCGAAGVGLNPLHALFDDEGDD
CSPYAPNSRLFLNSIYIDVAALPELPENFATEHAAEIERLRNAEFVDYAGVAALKQRALR
LAFAQFNKWTTLKRRAAFDAFRERGGATLARFASFEALRRKYKIAWWDWPEPWRAPDDDA
LADLRRGEDADAVAFAEFVQWCAHEQLQACVDLARALDLPVGLYLDIAVGVRAGGFDAWA
EQSAITRLLSVGAPPDQLNTAGQDWGLAGFNPAGLAANGFAPFRRMLAASMRYAGAVRLD
HVLGLNRIYVVPEGAAPDGGAYIRMPFEAMLASVAIESVSHRCIVIGEDLGTVPDGFREN
LADWAIWSYRVMMFERGADGGFVAPEHYPARALVTFSTHDLATYAGWRQGHDVALKEEIG
INPGESGRERENAVSALDAALGQAGESGADFSAVLSTLACTPSRLLGVAIEDLLGVVDQA
NVPGTMHEHPNWRRKLPVPIEAWDRAIDKDAIQRALELRIVSHEPA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcccgagaaaatgtcccgatacgggattgagacaagttttatcgacggcaaa
ggccacacccacacaatcgacgagcagactttccatcggattgcggatgctctgggccct
acgcctgcggggccagcgcctgttatttttcggactgtgaatggcgtggagaaaaatgat
cttgtcgcaaggctgtcacacctcccggcatggcgcgtgtgtgatgcgaatggcgacgta
ctcgcctctgagatggatggcgtctcgggtgaaagcgaccttcccttcggcgtctatcgt
ctgcaagacagcgacgctggcgagcgatcgctgattattgcgcccgagcacgcttatgaa
ggtgcgttcgatcgccgatggattctgtcggtgcagctctacggcgtgcgctcggagcgc
aactggggcatcggcgatttttccgatctgcaaacgctgctgcgttggtccgcgacgtgt
ggcgcggcgggagttggcctcaatccgttgcatgcgttgtttgacgatgaaggcgacgat
tgcagtccgtatgcgccgaacagtcgcctgttcctgaattcgatctacatcgacgtcgcg
gcgctgccggaattgccggagaattttgcgaccgagcatgcggcagagatcgagcggctg
cggaatgccgagttcgtcgattatgccggcgtcgcggcgctaaagcagcgtgcgctgagg
ctcgcgttcgcgcagttcaacaaatggacgacgctgaagcgccgcgcggcgttcgatgcg
tttcgcgagcgcggtggcgcgacgctggcgcggtttgcctccttcgaagcgctgcggcgg
aaatacaagatcgcctggtgggattggcctgagccatggcgcgcgccggatgacgatgcg
ttggcagatctgcgccgtggcgaagatgcggatgctgttgcgtttgccgaattcgtgcag
tggtgcgcgcacgagcaattgcaggcgtgtgtcgatcttgcccgcgcgctcgatctgccg
gtcgggctttatctcgatatcgccgtcggcgtgagagccggcgggttcgacgcgtgggcc
gagcagagcgcgatcacccgcctcctctcggtcggtgcgccgccggaccagctcaacacc
gcggggcaggattgggggctcgccggcttcaacccggcagggcttgccgcgaatggcttt
gcgccgtttcggaggatgctggcggcgtcgatgcgctatgccggcgcggtgcggctcgat
catgtgctggggctgaaccggatctatgtcgttccggaaggtgccgcgccggatggtggc
gcctacatccgcatgccgttcgaggcaatgcttgcgagtgtcgcgatcgagagcgtcagc
catcgctgcatcgtcatcggtgaggacctcgggacggtgccggatggctttcgcgaaaat
ctcgccgattgggcgatctggtcctatcgggtgatgatgttcgagcgtggtgcggatggc
gggttcgtcgcgcccgagcattatcccgcgcgagcgctcgtcaccttcagcacgcatgat
ctcgcaacctatgcgggctggcggcaggggcacgacgtcgcgctgaaggaagagattggc
atcaatccgggcgagagcgggcgggagcgggagaatgccgtctccgcgctcgacgccgcg
cttgggcaggcaggagagtccggtgccgatttcagcgcggtgctgagcactcttgcttgc
acgccgtcgcgtttgttgggcgtcgcgatcgaggatcttctcggcgtcgtcgatcaggcc
aatgtgccgggcacgatgcatgagcacccgaactggcggcgcaagctgccggtaccgatc
gaggcgtgggatcgcgccatagataaagacgccatccagcgtgctctggaattgcggatt
gtatcgcacgaaccggcctga

DBGET integrated database retrieval system