KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c10710Help
Entry
OCA5_c10710       CDS       T01617                                 

Gene name
aceA
Definition
isocitrate lyase AceA (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCA5_c10710 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCA5_c10710 (aceA)
Enzymes [BR:ocg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     OCA5_c10710 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1142429..1144066
Genome map
AA seq 545 aa AA seqDB search
MNYQARDITDHAVQGPSSYESEIKAAEALLKDKPTWNGVTAEAIARMRLQNRFTTGLDVA
RYTAALMRADMAAYDADPTKYTQSLGCWHGFVAQQKLISIKKHFGGKTDRCYLYLSGWMV
AALRSEFGPLPDQSMHEKTTVPDLIRELYSFLRQADSRELNDIFRELDAAREAGDKAREA
AAIAKIDGFHTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQ
DGKVTVPHEVFLAKIRACRHAFLELGVEDGIIVTRTDSLGAGLTQQIAVSHKPGDLGDQY
NSFLDCEEVDATKIGNGDVIISRNGKLLRPKRLASNLYQFRPGTGADRCVLDCITSLQNG
ADLLWIETERPNIAQVASMVDRIREVIPNAKLAYNNSPSFNWTLNFRWQVFDEWKAAGKD
VSKYNRAELMKAEYDDTPLAIEADQLIRTFQADSAKRAGVFHHLITLPTYHTEALTMNNL
AKDYFGGQGMLGYVKHVQRQEIRQGIACVKHQNMAGSDIGDDHKEYFAGDAALKAGGVHN
TMNQF
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcaggcacgcgacatcaccgaccatgcggtccagggtccgtcttcctacgaa
agcgagatcaaggcggccgaagccttgctcaaggacaaacccacctggaacggcgtcacg
gcggaagccattgcccgcatgcgcctgcagaaccggttcacgacaggtctcgatgtcgcg
cgctacacggcggccctgatgcgtgcggatatggccgcgtatgacgcggaccccaccaaa
tacacccagtcgctcggttgctggcacggctttgtcgcgcagcagaagctgatctcgatc
aagaagcatttcggcggcaagaccgaccgttgctacctgtatctgtcgggatggatggtc
gcagcgctgcgctcggaattcgggccgctgccggatcagtcgatgcacgagaagaccacc
gtgccggatctcatcagggaactctactcgttcctgcgtcaagccgactcgcgcgaactc
aacgacatctttcgcgaactcgatgccgcgcgtgaggccggcgacaaggccagggaagcc
gcggcgatcgcgaagattgatggcttccacactcatgtcgtgccggtgattgccgacatc
gatgccggcttcggcaacgcggaggcgacgtatctgctcgcaaagaagatgatcgaagca
ggcgcctgcgcattgcagatcgagaatcaggtctccgacgagaagcagtgcggccatcag
gacggcaaggtcactgtgccgcatgaagtgttcctggcgaagatccgcgcttgccgccat
gcgttcctcgaactcggtgtcgaagacggcatcatcgtcacccgtaccgactcgctcggt
gccggcctgacccagcagatcgccgtcagccacaagccgggcgatctcggcgaccagtac
aacagcttcctcgattgcgaggaggtcgatgccaccaagatcggcaacggcgacgtcatc
atcagccgcaacggcaagctgctgcgcccgaagcgtctggcgagcaacctgtatcagttc
cgtccgggtacgggtgcggaccgctgcgtgctggattgcatcacgtcgctgcagaacggc
gcggacctgctgtggatcgaaaccgagaggccgaacatcgcgcaggtcgcgagcatggtc
gatcgcatccgcgaggtgatcccgaacgcgaagctcgcctacaacaactcgccgtcgttc
aactggacgctgaacttccgctggcaggtgttcgacgagtggaaggcggccggcaaggac
gtcagcaaatacaaccgcgccgagttgatgaaggcggaatacgacgacacgccgctggct
atcgaagccgaccagttgatccgcacgttccaggcggattcggcgaagcgggccggcgtc
ttccaccacctcattacgctaccgacctatcacaccgaggccctgacaatgaacaatctc
gccaaggactatttcggtgggcagggcatgctcggctacgtcaagcacgtgcagcgtcag
gaaatccgccagggcattgcctgcgtcaagcatcagaacatggccggctcggacatcggc
gacgaccacaaggaatactttgccggtgatgcggccctgaaggcgggcggcgttcacaac
accatgaaccagttctga

DBGET integrated database retrieval system