KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c14210Help
Entry
OCA5_c14210       CDS       T01617                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase FolK (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ocg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1545546..1546031)
Genome map
AA seq 161 aa AA seqDB search
MSSVLIALGGNVGDVRATFKSAISHICGATQASLVARSSDYRTPPWGEEDQPPFINACIE
IRTSLDPLALLATLHRIEKRFGRDRANERRWGPRTLDLDILAYDNGTISTPELTLPHPRL
FERAFVLVPLAEIAPDRKIGERTPREALAQHSTEGIERLSD
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtgtcctgatcgcgctgggcggcaatgtcggcgatgtccgcgcgacgttcaaa
tccgccatttcgcacatttgcggcgcgacgcaggcctcgcttgtcgcccgctcatctgac
taccgcacgccgccatggggcgaggaagaccagccgcccttcatcaacgcctgcatcgag
atcagaacgtcgctcgacccgctcgcgctgctcgccacgctgcaccggatcgagaaaagg
tttggccgcgaccgcgccaatgaacggcgctggggtccgcgcacgctcgacctcgacatt
ctcgcctatgacaacggcaccatctcaacgccggaactgaccctgccccacccgcggctg
ttcgagcgggcttttgttctggtaccgctcgcggaaatcgccccagacagaaaaatcgga
gagcgaacgccgcgcgaggcgctggcgcagcactcgaccgaaggtatcgagcggctgagc
gattag

DBGET integrated database retrieval system