KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c14230Help
Entry
OCA5_c14230       CDS       T01617                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OCA5_c14230 (folP)
Enzymes [BR:ocg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     OCA5_c14230 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1546396..1547250)
Genome map
AA seq 284 aa AA seqDB search
MTARSSTFGTSASTRHDILPALLGKPHPLVMGVLNVTPDSFSDGGRFLDPATALAQAERM
VAEGADILDVGAESTRPYGSVRISEEDELARLRPILPALTRLGVPISIDTMKAGVAAWAL
DQGAAIANDVWGLHRDPAMARLAAARGVPVVVMHNRDAADPAIDIMDDIAAFFTRSLAIA
DEAGLPRERIVLDPGIGFGKTAEQSMIALARLGELGRFGLPILVGASRKRFIASISPSEP
DQRIGGSLAAHLIAVQNGARIIRAHDVHETVQALRVAAAIGDKR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgctcctcaacctttggcacttcagccagcacccggcacgacatattgccc
gcgctgctgggaaagccgcatccgctggtgatgggggtgctcaatgtgacgccggattcc
ttctccgacggcggccgttttctcgatcccgccaccgcgcttgcccaggccgagcggatg
gtggctgaaggcgccgacattctcgatgtcggagcggaatcgacccgtccctacggctcg
gtccggatttcggaagaggacgaactggcgcggctgcggcctattctgcccgccctcacc
cggctcggcgtgccgatctcgatcgacaccatgaaggccggcgtcgccgcctgggcgctc
gatcagggtgccgcgattgcaaacgacgtctgggggctgcaccgcgaccccgcgatggcg
cgccttgcggccgcacgtggcgtgcccgtcgtggtgatgcacaatcgcgatgccgccgac
ccggccatcgacatcatggacgacatcgcggccttcttcacccgctcgctcgcaatcgcc
gacgaggccggcctgccgcgcgagcgcatcgtgctcgatcccggcatcggcttcggcaag
accgccgagcaaagcatgatcgcgctggcccgccttggcgaactgggccggttcgggttg
cccattctggtgggcgcttcgcgcaagcgcttcatcgccagtatctcgccatccgaacca
gatcagcgcatcggcggctctcttgcggcgcatctcatcgcggttcagaatggtgcccgc
atcattcgcgcgcatgacgtccatgagaccgtccaggcgctgcgcgtggcggctgcaatc
ggggacaagcggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system