KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c14950Help
Entry
OCA5_c14950       CDS       T01617                                 

Gene name
sucC2
Definition
succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCA5_c14950 (sucC2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCA5_c14950 (sucC2)
   00640 Propanoate metabolism
    OCA5_c14950 (sucC2)
   00660 C5-Branched dibasic acid metabolism
    OCA5_c14950 (sucC2)
Enzymes [BR:ocg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OCA5_c14950 (sucC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1614981..1616153
Genome map
AA seq 390 aa AA seqDB search
MNLHEFQAKQILAGYGLPSPGGKVAITAEQAVAIYNELGGGDMAVKAQVHAGGRAQAGGV
KIVHSEKEAKAVATSLLGKKLVTAQTGPAGRVVRRIYLEKAVEPVRELHVALLIDGSSGT
LTLFGSARGGDDIEERAARGELRLERLSLGDGSKRQADNVAAFATRIRIDAGSVAAFEKI
VDGLRRAFVDLDASLIEINPLAILRDGSFQALDVKMVLEDNALFRHPDLTALRDEDEIDH
REVEAQRHQLNFVSMDGNIGVVANGAGLGLASVDLVCAAGGKPANFMDIRTTATSLDVAY
GFGLLLDNPATRAIFLNVHGGGMQPCDTIAEGLGIAMRRTGRSLPIVARLAGNNAEFARS
RFVNFGCPVVDCPDMWTAATKVVAIAQKGG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctgcacgagtttcaggccaaacaaatcctggcgggctacgggttgccctcgccg
ggcggcaaggttgccatcacagccgaacaggctgtcgccatttataatgagctcggcggc
ggtgacatggccgtcaaggcgcaggtccatgccggtggccgcgcacaggcgggcggcgtc
aagatcgtccattccgagaaagaggcaaaggcggtcgcgacctcgctgctcggcaagaag
ctcgtcaccgcgcagaccggcccggccgggcgcgtggtccggcgcatctatctcgaaaag
gcggtcgagcccgtgcgcgagctgcacgtcgcactcctgatcgacggctcctccggtacc
ctcacattgttcggcagcgcccgtggcggcgacgatatcgaggagcgtgccgcgcgcggc
gagttgcggctcgagcgtctcagcctcggcgatggctccaagcggcaggccgacaacgtc
gcggcttttgcgacgcgcatccgcatcgatgccggttcggtggcggccttcgagaagatc
gtcgatggcctgcgccgcgcctttgtcgatctcgacgcaagcctgatcgaaatcaacccg
ctcgcgatcctgcgcgacggcagcttccaggcgctcgacgtcaagatggtgctggaagac
aacgcgctgttccgccatcccgacctcaccgcactgcgcgatgaggacgagattgatcat
cgcgaggtcgaggcgcagcgccaccagctcaacttcgtcagcatggacggcaatatcggc
gtggtcgccaacggcgcgggcttaggccttgcgagcgtcgacctcgtctgtgcggcgggc
ggcaagcccgcgaacttcatggatatccgcaccacggcgacgagcctcgatgtcgcctac
ggcttcggcctcctgctcgacaatcccgcgacgcgtgcgattttcctcaatgtccacggc
ggcggcatgcagccttgcgacaccatcgcggaaggcctcggcatcgccatgcgccgcacc
ggccgctcgttgccgatcgtggcgcggctcgctggcaacaacgccgagttcgcgcgttcg
cgcttcgtcaatttcggttgcccggtcgtcgattgtccggacatgtggacggccgcgacc
aaggtcgtggccattgcgcagaagggaggatga

DBGET integrated database retrieval system