KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c16910Help
Entry
OCA5_c16910       CDS       T01617                                 

Definition
DNA polymerase III, chi subunit
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OCA5_c16910
   00240 Pyrimidine metabolism
    OCA5_c16910
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    OCA5_c16910
   03430 Mismatch repair
    OCA5_c16910
   03440 Homologous recombination
    OCA5_c16910
Enzymes [BR:ocg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     OCA5_c16910
DNA replication proteins [BR:ocg03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     OCA5_c16910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1831200..1831664
Genome map
AA seq 154 aa AA seqDB search
MTEVLFYHLQDMRLEAVLPPLIEKSLERGWRVVVQAGSEERAEALDSHLWTYRDDSFLPH
GTWRESDAAEQPVVLTVRDDNPNDATVRFLVDGATVPEDCTAYQRIVLIFDGDDDGALQA
ARAAWTDCKARGYEQTYWQADERGRWQRKDGGGT
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagttctgttctatcatttgcaggacatgcggcttgaggccgtgctgccgccg
ctcatcgagaaatcgcttgagcgcggctggcgcgtcgtggtgcaggcgggatcggaagag
cgcgccgaggcgcttgattcccatctatggacctatcgcgacgactcgttcctgccgcac
ggcacatggcgcgagtcggatgcggctgagcaacccgtcgtgctcacggtgcgcgacgat
aatccgaacgatgcgaccgtgcgctttcttgtcgatggcgccactgtcccggaagattgc
accgcgtatcaacgcatcgtgctgatcttcgatggtgacgacgatggtgcactgcaggca
gcgcgtgcagcatggaccgattgcaaggcgcgcggctatgagcaaacctactggcaggcg
gacgagcgcggccgctggcagcgcaaggacggcggtggcacttaa

DBGET integrated database retrieval system