KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c17290Help
Entry
OCA5_c17290       CDS       T01617                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase TrpC (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ocg01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ocg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1875680..1876477)
Genome map
AA seq 265 aa AA seqDB search
MSDILQKIERYKREEIASAKAAHPQAEVEAAARHAPALRGFAKAIRDRLAHKQFALIAEI
KKASPSKGLIRADFDPPALARAYEAGGATCLSVLTDTPSFQGHLDFMVAARAATSLPVLR
KDFMYDTYQVMEARAHGADCILIIMAALDDAAARDIEAAALDLGMDVLLEVHNEPELERA
LKLRSKLLGINNRNLRTFETTLATSEALAASVPNDRIMVGESGIFTPADIARLARVGIET
FLVGESLMRQTDVTSATRTLLAKAS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgacatcctgcaaaagatcgaacgctacaagcgcgaggaaatcgcctctgccaag
gctgcgcatccgcaggccgaggtcgaggcggccgcgcgccatgcgccggccctgcgcggg
tttgcgaaggcgatccgcgaccggcttgcgcacaagcaattcgcgctgattgccgagatc
aagaaggcgtcgccttcaaaaggcttgatccgcgccgatttcgatccgcctgcgctggcg
cgcgcctatgaggcgggtggcgcgacctgcctgtccgtgctcaccgacacgccctcgttt
cagggccacctcgattttatggtggcggcgcgcgcggccacctcactgccggtgctgcgc
aaggacttcatgtacgacacctatcaggtgatggaggcgcgtgcgcatggcgccgactgc
atccttatcatcatggcggcgctcgatgacgccgccgcacgcgacatcgaggctgcagcg
ctcgacctcggcatggatgtgctgctcgaagtacacaacgaacccgagcttgagcgcgca
ttgaagctgcgctcaaagcttctcggcatcaacaaccgcaacctgcgcaccttcgagacc
acgcttgcgaccagcgaggcgctcgccgcctccgtaccgaatgatcgcatcatggtcggc
gagagcggcatcttcacgcccgccgacattgcgcggctggcccgcgtcggcatcgagacg
ttcctcgtcggcgaaagcctgatgcggcagaccgacgttacatccgccacccgcaccctg
cttgcgaaggcctcatga

DBGET integrated database retrieval system