KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c17320Help
Entry
OCA5_c17320       CDS       T01617                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00010  Glycolysis / Gluconeogenesis
ocg00051  Fructose and mannose metabolism
ocg00562  Inositol phosphate metabolism
ocg00710  Carbon fixation in photosynthetic organisms
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01120  Microbial metabolism in diverse environments
ocg01130  Biosynthesis of antibiotics
ocg01200  Carbon metabolism
ocg01230  Biosynthesis of amino acids
Module
ocg_M00002  Glycolysis, core module involving three-carbon compounds
ocg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCA5_c17320 (tpiA)
   00051 Fructose and mannose metabolism
    OCA5_c17320 (tpiA)
   00562 Inositol phosphate metabolism
    OCA5_c17320 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCA5_c17320 (tpiA)
Enzymes [BR:ocg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OCA5_c17320 (tpiA)
Exosome [BR:ocg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OCA5_c17320 (tpiA)
  Exosomal proteins of bladder cancer cells
   OCA5_c17320 (tpiA)
  Exosomal proteins of melanoma cells
   OCA5_c17320 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEI06446
UniProt: B6JFZ2
Position
1879633..1880388
Genome map
AA seq 251 aa AA seqDB search
MPGKIRPLIAGNWKMNGLKASLGELAAIGKGAGEVWRRVDLLICPPATLIFPAAAAMIGS
KVAIGGQDCHAEASGANTGDISAEMLADAGATYVIVGHSERRTDHGETDAVVRAKAEAAW
RAGLVAIVCVGETRAERDAGRAAEVVGRQLDGSVPDGARAANLVVAYEPVWAIGTGLTPT
SQDIEEIHAVIRQNLTGRFKAEGEGVRLLYGGSLKPANAAEILALANVNGGLIGGASLKA
ADFLAIAEACP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcaagatccgaccgctgatcgcggggaactggaagatgaacggcctcaaggcc
tcgctcggtgaacttgcggcgatcggcaagggtgcaggcgaagtctggcgcagggtcgat
cttctgatctgcccgcctgcgacgctgatcttcccggcggccgctgccatgatcggatcg
aaggtcgcgatcggcgggcaggactgtcacgctgaggcttccggcgccaataccggcgat
atctccgccgagatgctggccgatgcgggggccacgtacgtcatcgtcgggcactccgag
cgccgcaccgaccatggcgagaccgacgcggtggtgcgggcgaaggcggaggctgcctgg
cgcgccgggcttgtcgccatcgtctgtgtcggcgagacgcgggccgagcgcgatgcgggc
cgggccgccgaggtagtcggccgccagcttgatggttcggttcccgacggggcgcgtgcg
gccaatctggtcgtggcctacgagccggtctgggcgatcggaaccgggctcacgccgacc
tcgcaggatattgaagaaatccatgccgttatccggcaaaacctgacaggccggtttaag
gcggaaggcgagggtgtgcgccttctttatggcgggtcgctgaagcctgccaacgccgcc
gaaatcctcgcgctggccaacgtcaatggcggcctgattggtggggcgagcctcaaggcg
gccgacttccttgcgatcgcggaggcctgtccttaa

DBGET integrated database retrieval system