KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c19190Help
Entry
OCA5_c19190       CDS       T01617                                 

Definition
glycoside hydrolase, family 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Brite
Enzymes [BR:ocg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     OCA5_c19190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2069093..2070193)
Genome map
AA seq 366 aa AA seqDB search
MQHITRRDMIATCAGATVALLRGTESRSSIGESLGDAAASKNVMFGAAAAEAIDHDIGYR
DLYISQARLITTDTALKMGTVASRPGVKRFEPADKLLQFCTTNRIGLRGHCVIWNEWVPQ
WVRNMALAERRSFFDGYIEDVVGRYVGKLQSWDIVNEPFWPGHKAPGGYRLGPWYDAFGT
DYVRRAFERAGAVDKATKFVLNEAQTERDDPLGLAVREGLLKLVKELKDSGVRLDVVGLQ
GHLQPKYKHDPVRFADFVHKLSELGVDIYITEFDVRDDTFPDDIRARDELVAKTAEAFLD
NVLQISAVKAVIAWELADQYSFYTDLAKKKDPSAARLPRPLPYDSNLQKKPLWFAMQRAF
TNARRA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacatcacgcgacgcgatatgatcgcaacatgcgctggcgcgacagttgctttg
ttgcgcgggacagaatcacgatcgtcgattggcgagagtcttggtgatgcagctgcaagc
aagaatgtgatgttcggcgccgctgcagcggaagcaatcgatcacgatatcggctatcgc
gacctctacatctctcaggcacggctcatcacgacagatactgccttgaagatgggcact
gttgcatcacggccgggcgtgaagcgcttcgagcccgcggacaagctgttgcaattttgc
acgacgaaccggatcggtctgcgaggtcactgcgtcatctggaacgagtgggttccgcaa
tgggtccgcaacatggcgcttgccgagcggcgatcgttcttcgatggctacatcgaagac
gtcgtcggccgttatgtcggcaagctgcaatcatgggacattgtgaatgagccgttctgg
ccggggcacaaggcgccgggcggatacaggttgggcccatggtacgatgcattcggaacg
gattatgtccgccgtgctttcgagcgggcaggcgctgtcgacaaggctacgaaattcgtt
cttaacgaagcgcagacggaacgcgatgatccactcggactcgcggtgcgagaagggctc
ctcaaactggtcaaggagttgaaggattccggtgttcgtctggacgtcgttgggctgcag
gggcatctgcaaccgaaatacaagcacgatcccgtgcgatttgccgatttcgttcacaag
ctcagcgagcttggtgtcgacatctacatcacggaattcgatgtacgggacgatacgttt
ccggatgatatccgtgctcgcgacgagctggtggcaaagactgcggaagcgtttctcgac
aatgtgctgcagatctcggcggtgaaggcggtgatcgcctgggagcttgccgatcaatat
tcgttctacaccgatctcgccaagaagaaggacccgtccgccgcgcggctgccgcgcccg
ctgccctacgattcgaatctgcagaagaagccgctgtggttcgcgatgcagcgtgccttc
accaacgcacgccgggcatga

DBGET integrated database retrieval system