KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c19430Help
Entry
OCA5_c19430       CDS       T01617                                 

Definition
protein-L-isoaspartate
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Brite
Enzymes [BR:ocg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     OCA5_c19430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2096803..2097462)
Genome map
AA seq 219 aa AA seqDB search
MPDALTSRWNMVDSQVRTADVTDLRLIEAMRATPREAFLPESQKALAYLDRDIALDGEDN
VYLIKPMVLGRLLQAADIEPTDRVLVTGGAAGYAAALAGRLGAEVVAVCANDKVAAASRS
ALEASGLSNITVTAGEAGQGDAARGPYDVIVLHGATEVVPQALYDQIKPGGRLVGVFAQS
VPSRATLVTRSEADFGARTLFDAAAPVLPGLKRLPGFTF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgctctgacttcccgctggaacatggtcgattcccaggttcgcaccgccgat
gtcacggatctgcgcctgatcgaggccatgcgggcgaccccgcgcgaggcatttcttccc
gagagccagaaggcgcttgcctatctcgatcgcgacatcgccctcgacggtgaggacaat
gtttatctcatcaagccgatggtgctcggccggctgctgcaggctgccgatatcgagccg
accgatcgggttctggtgacaggcggcgcagccggttatgcggcagcgctggcgggtcgt
ctcggggctgaggtcgtcgcggtctgtgccaatgacaaggtcgccgcggcaagccgctcg
gcgctcgaggctagcggcctctccaatatcacggtcacggcgggcgaggccgggcagggc
gatgctgccagggggccttacgacgtcatcgtgctccatggcgcgaccgaggtggttccg
caggccctctatgaccagatcaagcccggcggacgcctcgtcggcgtgttcgcgcaatct
gtgccctcgcgcgccaccctcgtgacccgctcggaggcagattttggcgcccggaccctg
ttcgacgccgctgcacccgttcttcccggccttaagcggttgccgggctttacattttga

DBGET integrated database retrieval system