KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c20200Help
Entry
OCA5_c20200       CDS       T01617                                 

Definition
(GenBank) GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Brite
Enzymes [BR:ocg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     OCA5_c20200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2188538..2189605
Genome map
AA seq 355 aa AA seqDB search
MISLLEEHERTLAFAEVALGQIKSLRQSAIPRNYEIWYVYATGYNIELNKVINETLQHNG
RLTEADLEQIHETYLSPTRMTDRIDKVGSRVINEIDDVMSLITDAVGMTGSFSEDLDSAS
KRLVKAKDKAQINLIVHALLQSTREMSLTNKALEARLATSRLEIASLQDSLEAIRTESLT
DPLTSLGNRKYFDRALESAVEHASHHDEPLSLLMVDIDHFKSFNDNYGHLTGDQVLRLVA
LALKANIKGQDLTARYGGEEFVVILPNTSMRQALAVADNIRRAVMSKQLKKKSTGEILGR
VTISAGVSTFRPGDDAPALIDRADACLYAAKRHGRNRVICEADPEFTPNVRIQVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagtcttcttgaagaacacgagcgcaccctcgcgttcgccgaagtggcgttgggc
cagatcaagtccctgcgccagagtgcgatccctcgcaattacgaaatctggtacgtctac
gcgaccggctacaacatcgagctcaacaaggtcatcaacgagacgttgcagcacaacggc
cggctgaccgaggccgatctcgaacagatccacgaaacctatctgtcgccgacccgaatg
accgaccgcatcgacaaggtcggatcacgcgtcatcaacgagatcgacgacgtgatgagt
ctcatcaccgacgcggtcggtatgacgggttctttcagcgaggacctcgacagcgcaagc
aagcgtctcgtcaaggcgaaggacaaggcgcagatcaatctgatcgttcacgcgcttctt
caatcgacgcgggagatgagcctcaccaacaaggcgctggaggcgcggctcgccacgtca
cgcctcgagatcgccagcctgcaggacagccttgaagcgatccgcaccgagagcctgacc
gaccctctcacgtctctcggcaatcgcaaatatttcgatcgcgcgctggaatccgcggtg
gagcacgcaagccatcatgacgagccgctgtcgctgctgatggtcgacatcgatcacttc
aagtcgttcaacgacaattacggccacctcaccggcgaccaggtgcttcgcctggtggcg
ctcgcattgaaagccaacatcaagggtcaggacctgaccgcgcgctatggcggcgaggag
ttcgtggtcatcttaccgaacacctcgatgcgtcaggctttggctgttgccgacaacatc
cgccgcgccgtgatgtcaaagcagctcaagaagaagtcgaccggcgaaatcctcggtcgc
gtcacaatctccgccggcgtttcgaccttccggcccggcgacgacgcccccgctctgatc
gaccgcgccgacgcctgcctctatgccgccaagcggcacggccgcaatcgcgtgatctgc
gaagcagaccccgaattcacaccgaatgtccggattcaggtggcctga

DBGET integrated database retrieval system