KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c20620Help
Entry
OCA5_c20620       CDS       T01617                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase Dxr
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00900  Terpenoid backbone biosynthesis
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCA5_c20620 (dxr)
Enzymes [BR:ocg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     OCA5_c20620 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-ProteinID: AEI06769
UniProt: B6JH72
Position
complement(2245402..2246625)
Genome map
AA seq 407 aa AA seqDB search
MNAVPLRQSEPMPQGERVVTILGATGSIGQSTADLVRRGRGRYRVEALTAHSNVAELAKL
ARELGARFAAVAKEECYAELKAALAGSGIEVGAGESALVEAALRPANWVMAAMSGAAGLK
PAMAAAGRGEIVALANKECLVCAGEAFMRHAAANNATVLPVDSEHNAIFQSLGAGRREDL
VRIILTASGGPFRTATREQIENATVEQALKHPNWSMGRKITIDSATMFNKALEIIEAFHL
FELKADQIDVLVHPQSIIHGLVEFADRSVVAQMGAPDMRTPIAHCLGWPHRIDGPATQLD
LAKLTQLTFEAPDPVRFPALRLVREALVAGGAAPTVLNAANEVAVASFLDRKIPFGGIAR
LVEATLEALVAKGTAKAPQSADEALAVDHTARKTAAALLPEIALKAS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgtgcctttacgtcaaagtgagccgatgccgcagggcgagcgtgtcgtcacg
atcctcggcgccaccggctcgatcgggcagagcacggccgatctcgtgcgccgcgggcgc
gggcgttaccgcgtcgaggcgctgaccgcgcacagcaacgttgccgagcttgccaagctt
gcacgcgagctcggtgcgcggttcgctgcggtcgccaaagaggaatgttacgccgagctc
aaggcggcgctcgcaggctcgggcatcgaagtcggtgcgggcgagagcgcactcgtcgag
gcggcgctgcggcctgcgaactgggtgatggcggcgatgagcggcgcggccgggctgaag
cccgcaatggctgccgccggtcgcggcgagatcgtcgcgcttgcgaataaagagtgtctc
gtctgcgcgggtgaagcgttcatgcgtcacgcggcagcgaacaacgcgaccgtgctgccg
gtcgattccgagcacaacgcgatcttccaatcgctcggcgcgggccggcgcgaggatctc
gtgcgcatcatcctcaccgcatcgggcggaccattccgcaccgcgacgcgcgagcagatc
gaaaacgcgaccgtggaacaggcgctcaagcatccgaactggagcatgggccgcaagatc
accatcgattccgcgaccatgttcaacaaggcgctcgagattatagaggcgttccatctg
ttcgaactaaaggccgaccagattgacgtgctggtgcatccgcagtcgatcattcacgga
ctcgtcgaattcgccgaccgttcggtggtggcgcagatgggggcgcccgacatgcgcaca
ccgatcgcgcattgcctcggctggccgcaccggatcgacggtccggcgacgcagctcgat
ctggcgaagctgactcagcttaccttcgaggcaccggacccggtccggttcccggcgttg
cggctggtacgggaagcgctcgttgctggaggcgctgcgccgaccgtgctcaatgcggcg
aacgaggtcgcggtcgcatccttcctcgatcgcaagattcccttcggcggcatcgcacgg
cttgtcgaggcgacgctcgaggcgctggttgcgaagggaacggcgaaggcgccgcaaagc
gctgacgaggctttggctgttgaccataccgcgcgaaaaaccgcggcggccctcttgcct
gaaattgccttaaaggcatcctag

DBGET integrated database retrieval system