KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c21630Help
Entry
OCA5_c21630       CDS       T01617                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase HemB (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ocg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2349465..2350538
Genome map
AA seq 357 aa AA seqDB search
MAIKFGRPIEARDTAPSFTSGTDASPAALHLTTRMRRNRKSEWARRLVRENVLTTDDLIW
PLFAADGDNRREAVASMPGVERLSVDQCVRDAERAAKLDIPCIALFPYTDPALRDPQGSE
ALNADNLVCRTVRAVKKEFPDLGVLCDVALDPFTSHGHDGLLRDDGVIMNDETVAVLARQ
ALVQAEAGCDVIAPSDMMDGRIGAIRDALDAAGFGDVQIMAYAAKYASAFYGPFRDAVGS
AKALTGDKRTYQMDPANSDEALREVELDIAEGADMVMVKPGLPYLDILRRVKDTFAMPTF
AYQVSGEYAMLMAAANNGWLDGERAMMESLLAFKRAGADGVLTYFAPRAAEKLRTRG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaattcggacgaccgatcgaagcccgcgacactgcgccctctttcacctcc
ggcacagacgcctcgcccgcagcgctgcatctcaccacgcggatgcgccgcaaccgcaag
agcgaatgggcgcgccggctcgtgcgcgaaaatgtgctgacgacggacgatctgatctgg
ccgctgtttgccgcagatggcgacaacaggcgcgaggcggttgcctcgatgccgggcgtg
gaacggctcagcgtcgatcaatgcgtccgcgatgcggagcgcgcggccaagctcgacatc
ccgtgcattgccctgttcccctacactgatcctgccttgcgcgatccgcagggttccgag
gcgctgaacgcggacaatctggtgtgccggactgttcgcgccgtcaagaaagagtttccc
gatctcggcgtgctgtgcgacgtggcactcgatccgttcaccagccatggccatgacggt
ttgttgcgcgacgatggcgtcatcatgaacgacgagacggtcgccgtgcttgcgcgtcag
gcgctggtgcaggcggaagccggctgcgacgtcatcgcaccttccgacatgatggacggc
cgtatcggcgcgatccgcgatgcgctcgacgctgcgggattcggcgatgtgcagatcatg
gcctatgcggcgaaatacgcctccgccttctacggcccgttccgcgatgcggtcggctcc
gcgaaggcgctcaccggcgacaagcgcacctatcagatggacccggccaattccgacgaa
gcgctgcgcgaggtcgaactcgatatcgccgagggcgcggacatggtgatggtgaagccg
ggcctcccctatctcgatatcctgcggcgagtgaaggacaccttcgcgatgccgaccttc
gcctatcaggtgtccggcgagtacgcgatgctgatggcggcggcgaacaatggctggctc
gacggcgaacgcgcgatgatggaaagcctgctcgcgttcaagcgcgccggtgctgacggc
gttctcacctacttcgcgccgcgagcggccgagaagctgcgcaccaggggctaa

DBGET integrated database retrieval system