KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c26950Help
Entry
OCA5_c26950       CDS       T01617                                 

Gene name
folA
Definition
dihydrofolate reductase FolA (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ocg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ocg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2864987..2865511)
Genome map
AA seq 174 aa AA seqDB search
MSASAPAVVFIVAIADNGVIGRDNTMPWHLRSDLQRFKQLTLNKPVVMGRKTFLSIGRPL
PKRTNIVVTRDPAFRAAGAVVATTLDAAYEIALGDALRRGASEIMVIGGAEIFHQWMPRA
TRLEITHVHAEPEGDTFLRFEMAEWQDVARSRPARGPDDSADFSYATYARAGRH
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcctctgcgcctgccgtcgtctttatcgtcgccattgctgacaatggcgtgatc
ggccgcgacaacacgatgccctggcacctgcgttcggacctgcagcggttcaagcagttg
acgctgaacaagccggtcgtgatgggccgcaagacgtttctctcgatcggccggccgctg
ccgaagcgcaccaacatcgtggtgacgcgtgatccggcgtttcgtgcggccggcgccgtg
gtggcgaccacgctggacgccgcctacgagattgcgctcggcgatgcgctgcggcggggc
gcatcggagattatggtgatcggcggcgcggaaatcttccaccagtggatgccgcgtgcc
acgcgcctcgagatcacccatgtccatgccgagccggagggagacacgttcttacggttc
gagatggcggaatggcaggatgtagcgcgcagccgtcctgcgcgcggacctgacgacagt
gccgatttttcctatgcgacatatgctcgcgcgggccgtcattaa

DBGET integrated database retrieval system