KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c27450Help
Entry
OCA5_c27450       CDS       T01617                                 

Gene name
fadJ
Definition
fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCA5_c27450 (fadJ)
   01212 Fatty acid metabolism
    OCA5_c27450 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCA5_c27450 (fadJ)
   00650 Butanoate metabolism
    OCA5_c27450 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    OCA5_c27450 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    OCA5_c27450 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCA5_c27450 (fadJ)
   00310 Lysine degradation
    OCA5_c27450 (fadJ)
   00380 Tryptophan metabolism
    OCA5_c27450 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCA5_c27450 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCA5_c27450 (fadJ)
   00281 Geraniol degradation
    OCA5_c27450 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    OCA5_c27450 (fadJ)
Enzymes [BR:ocg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     OCA5_c27450 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCA5_c27450 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     OCA5_c27450 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2925587..2927668)
Genome map
AA seq 693 aa AA seqDB search
MDSKILNAMKDHVLELGPEPSSGPYRHFKLTRDEDGIAWLLFDREGASANTLSSEVLEEF
SQILSVLESERPSGLVLRSAKRSGFIAGADINEFRGLSDVSIVEQQLGHGHDILNRLENI
KLPTVAVIHGFCLGGGLEVVLACNMRIAIEGARFGFPEILLGLHPGFGGTARATHLFNPL
EAMTMMLTGKTVEARKAKALGLVDAVTQERHVRNAVKDAIFGRLKRKRLKLTTLMNLGPA
RKLLASRMRKEAANKAPQENYPAPYALIDLWEKHGGNRADMLAAEKPSFAKLMVTSTAQN
LIRVFFLRDEMKKLAGGKSKIRHVHVIGAGAMGGDIASWCAHQGLRVTLADMQPAAIANA
MKRAADLFAKIARGRIAQRDTLDRLIPDMTGEGAKQADLIIEAVPEKLQLKQSIYAGLEK
VMRPDAILATNTSSIPLEELRASLQRPERLLGIHFFNPVSRLQLVEVISHDQVDQEALAT
AMKFVGGIDRLPLPVKSSPGFLVNRALMPYLMEALLMLDEKVDKLTIDEAAEKFGMPMGP
IELADQVGLDICLAVGDELRAKLGDSIPVAPDWLRDKVAKGELGRKTGRGFYEWKDGRVQ
KGHAHVHATPEMTDRLVLPMSNVCVACLREGIVDNPDTVDGAMIFGTGYAPFRGGPLNYA
RERGPENVANALLVLAEKYGERFKPDAGWATFR
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaaatcctcaatgcgatgaaggaccacgtccttgaactcgggcctgagccg
tcgtccggaccttatcgccatttcaagttgacgcgcgacgaagacggaatcgcctggctg
ctgttcgaccgcgaaggcgcaagcgccaacacgttgtcgagcgaggtgctggaagaattc
tcgcagatcctctcggtgctggagagcgagcgcccgagcgggcttgtgctgcgctcggcc
aagcgctccggcttcatcgcgggtgcggacatcaatgaattccgcggtctctccgatgtc
agcatcgtcgagcagcagcttggtcacgggcatgacattctcaaccggcttgagaacatc
aagctgccgacggtcgcggtaatccacggcttctgcctcggcggcgggcttgaggtcgtg
ctcgcctgcaacatgcggatcgcgatcgaaggcgcacgcttcggattcccggaaatattg
ctcggcctgcatccgggctttggcggcacggcgcgcgcaacgcatctgttcaatccgctc
gaagcgatgaccatgatgctgacgggcaagaccgtcgaggcgcgcaaagcgaaggcgctc
ggccttgtcgatgctgtgacgcaggagcgccacgttcgcaatgcagtgaaggatgcgatc
ttcggtcgcctgaagcgcaagcgcttgaagctgacgacgttgatgaaccttggtccggcc
cgcaagctgctggcttcgcgcatgcgtaaggaggctgccaataaagcgccacaggagaat
taccccgcgccctacgcgctgatcgatctgtgggagaagcacggcggcaaccgcgccgac
atgctggcggcggagaagccgtccttcgccaaactgatggtgacgtcgaccgcgcagaat
ctcattcgtgtgttcttcctgcgcgacgagatgaagaagctcgcgggcggcaagagcaag
atcaggcatgtccatgtgatcggcgccggtgcgatgggcggcgacattgcgtcgtggtgc
gcgcatcagggcctgcgcgtgacgcttgccgacatgcagccggcggcgattgcgaatgcg
atgaagcgcgcggcagatctgtttgcgaagatcgcccgcggccgcattgcccagcgcgac
acgcttgatcgtttgattccggacatgacgggagaaggcgcaaagcaggcggatctcatc
atcgaggccgtgccggagaagttgcagctcaagcaatcgatttatgccggccttgaaaaa
gtgatgcggccggacgccatcctcgcgaccaacacgtccagcattccgctcgaggagttg
cgcgcctcgctgcagcggccggagcgattgctcggcatccatttcttcaatccggtgtcg
cggctgcaactggttgaagtgatcagccacgatcaggtcgatcaggaggcgcttgcgacc
gcgatgaagttcgtcggtggaatcgatcgcctgccgctgccggtgaagagttcgccgggc
ttcctcgtcaaccgcgcgctgatgccgtatctgatggaagcgctgctgatgctcgacgag
aaggtggacaaactcaccatcgacgaggcggcggaaaagttcggcatgccgatgggcccg
atcgaactcgccgatcaggtcggcctcgatatctgtcttgcggtcggcgatgagttgcgc
gccaagcttggcgattccattccggttgcgcctgactggttgcgcgacaaggtcgcgaag
ggcgaactcggtcgcaagaccggacgcggattctacgaatggaaggacggccgcgtgcag
aagggccatgcccatgttcacgccacgccggaaatgaccgatcgccttgtgctgccgatg
tcgaacgtctgcgtcgcctgtttgcgtgaaggcatcgtcgacaatcccgatacggtggac
ggcgcgatgatcttcggcaccggctatgcgccgttccgcggcgggccgctcaactacgca
cgcgagcgtgggccggagaatgtcgccaacgcgctcttggtgctggcggagaaatacggt
gagcgcttcaagccggatgccggctgggcgacgtttcgctga

DBGET integrated database retrieval system