KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c29290Help
Entry
OCA5_c29290       CDS       T01617                                 

Gene name
nosZ
Definition
nitrous-oxide reductase NosZ (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ocg00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3125826..3127769
Genome map
AA seq 647 aa AA seqDB search
MSNHEDGKGVSRRALLGTTAAAGVGLAAGAALPIDKGFVTTAEAQTKGQPKAPAARPAVH
KTEVAPGDLDEYYVFFSSGQCGEMRIVGLPSMRELMRVPVFNRCSATGWGQTNESLKVLT
EGLTPQSREFLKSRGGTYINGDLHHPHISFTNGTYDGRYAFMNDKANTRVARVRLDVMKC
DKIIELPNQHTVHGLRVQKYPRTGYVFCNGEDGVPLPNDGKILDNPKEYRAILTAVDGDT
MQVAWQIIVDGNLDNVDADYQGKYAFSTCYNSEGGVTLAEMTASEQDWVVIFDLKRIEEA
VKKGDYKKMGGVPVLDGRKGSPFTRYVPVSNGPHGMNTAPDGIHVIANGKLSPTCTVFDV
RLFDDLFADKIKPRDTVVAEPELGLGPLHTAYDGKGNAYTTLFIDSQICKWNIDAARRAY
KGEKVDPILQKLDVHYQPGHNHTSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPENDQL
IDISGDKMVLVHDGPSFAEPHDATIVHRSKINPISIWDRADPFFADAVKQAKADGINLEA
DSKVIRDGNKVRVYMTSTAPAFGLEQFTVKQGDEVTVYVTNIDAVEDLTHGFTIVNYGVA
MEVAPQATASVTFTADRAGVYWYYCQWFCHAMHMEMKGRMLVEPKSV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccacgaggacggcaagggcgtcagccggcgagccttgctcggcacgacggct
gcagcgggcgtcggtctggctgcaggcgcggcactaccgatcgacaaggggtttgtcacg
acagcggaggcgcagaccaaggggcagccgaaggctcccgctgcgcggcccgcggtccac
aagaccgaggtcgcacccggcgatctcgacgaatactacgtgttcttctcctccggacag
tgcggcgagatgcgcatcgtcggcttgccttcgatgcgcgaactgatgcgcgtcccggtg
ttcaaccgctgctcggcgacgggctggggccagaccaacgagagtctcaaggtgctcacc
gaggggctgaccccccagtcacgtgagtttctgaagagtcgcggcggtacctacatcaac
ggcgatctgcatcacccgcacatctcgttcaccaacggcacctatgacggccgttacgct
ttcatgaacgacaaggccaacacccgcgtcgcgcgtgtgcgcctggatgtcatgaagtgt
gacaagatcatcgagttgccgaaccagcacacggttcacggcctgcgcgtgcagaaatac
ccgcgcaccggctacgtgttttgcaacggcgaggatggcgtcccgctgcccaacgacggc
aagatcctcgacaatccgaaggaataccgtgcaatcctcacggcggtcgacggcgatacc
atgcaggttgcctggcagattatcgtcgacggcaacctcgacaacgtcgacgccgactat
cagggcaagtacgccttctccacctgctacaactccgagggtggcgtcacacttgcggaa
atgaccgcaagtgagcaggactgggtcgtcatcttcgacctcaagcgcatcgaagaggcg
gtgaagaaaggcgactacaagaagatggggggcgtacccgtgctcgacggccgcaaaggc
tcgccgttcacgcggtatgtgccggtctccaacggtccgcacggcatgaacaccgcgccg
gatggcatccacgtcatcgccaacggcaaactgtcgccgacctgcaccgtgttcgacgtg
cggttgttcgatgacctgttcgccgacaagatcaagccgcgcgacacggtggtggcggag
cccgaactcggtctcggtccgctgcatacggcctatgacggcaagggcaacgcgtatacc
acgctgttcatcgacagccagatctgtaagtggaacatcgatgcggcccggcgtgcgtac
aagggcgagaaggtcgacccgatccttcagaagctcgacgtccactatcagcccggccac
aaccacacctccatgggtcagaccaaggaggccgatggaaaatggctgatctcgctgaac
aagttctccaaggaccgtttcctcaacgtcggtccgctgaagccggagaacgatcagctc
atcgacatctccggcgacaagatggtgctggtgcatgacggcccgagcttcgccgagccg
catgacgccaccatcgtccaccgttccaagatcaacccgatctcgatctgggaccgtgct
gacccgttctttgccgacgcggtgaagcaggccaaggcggacggcatcaacctcgaagcc
gactccaaggtgatccgcgacggcaacaaggtgcgcgtctacatgacgtccaccgcaccg
gcgtttggcctcgagcagttcaccgtgaagcagggcgacgaggtgacggtctacgtcacc
aacatcgacgcggtcgaagacctcacccacggcttcacgatcgtgaactacggcgtcgcg
atggaagtggcgccgcaggccacggcttcggtgacgttcacggccgaccgcgccggtgtc
tactggtactactgccagtggttctgccacgccatgcatatggagatgaaaggccgtatg
ctggtcgagccgaagtcggtgtaa

DBGET integrated database retrieval system