KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c29540Help
Entry
OCA5_c29540       CDS       T01617                                 

Gene name
cofE
Definition
F420-0:gamma-glutamyl ligase CofE (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    OCA5_c29540 (cofE)
Enzymes [BR:ocg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     OCA5_c29540 (cofE)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     OCA5_c29540 (cofE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3148337..3149104)
Genome map
AA seq 255 aa AA seqDB search
MVKSVTYTALPGLPLVEPGDDLGNIIAEGVRRAEIVVADGDIFVIAQKIVSKAENRYVDL
NEIVPSAQALELAKTVGKDPRHIEVVLSESTEVVRFRQNVMIVAHRLGFVMANAGIDESN
IAHDDGKARVLLLPKDPDASGEMLRQQLQRTFGVKIGVIINDSFGRPWRNGVVGVAIGSA
GIPSLQSMIGAPDLFNRAMRVTEIAIADELAAAASLVMGQAAEGLPVVHIRGFHSEAAHS
PASVLARPKAQDMFR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagagcgtcacatacactgcgcttcccggattgccgttggttgagcccggagac
gaccttggcaacatcattgccgagggcgtgcgacgtgctgagattgtcgtggccgatggc
gatatcttcgtgatcgcgcagaagatcgtttccaaggccgagaaccgttacgttgacctg
aatgagattgtgccgtctgcacaggcgctggagcttgcgaagacagtcggcaaagatcct
cgtcatatcgaagtcgttctttcggaatcgaccgaggtggtgcgtttccgccagaacgtg
atgatcgtagctcatcggctcggctttgttatggccaatgccggcatcgacgaatccaat
attgcccatgacgatggaaaggcacgcgttctgctgctgccgaaagacccggatgcaagc
ggtgagatgctccggcagcaactgcagcggacgtttggcgtcaagatcggtgttattatc
aatgacagcttcggccgcccatggcgaaatggggtggttggggtcgcgattggaagcgcg
ggcattccgtcattgcaaagcatgatcggcgcgcccgatctgtttaatcgtgccatgcgt
gtcaccgagattgcgatagctgatgaattggccgccgccgcttcattggtgatgggacag
gccgctgaagggctgccagtcgttcacatccgcggttttcacagtgaagccgcgcactct
ccggcttcggtgctggcacggccgaaggcgcaggatatgttccgatga

DBGET integrated database retrieval system