KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c30120Help
Entry
OCA5_c30120       CDS       T01617                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ocg00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3202581..3203525)
Genome map
AA seq 314 aa AA seqDB search
MTLVSIPANPVPEDVVSGTIKARDGVELRFARWAPPAGRKGTVCIFAGRGECIEKYFETV
HELRSRGFAVAMADWRGQGHSGRQLGDYRKGYVRSFKDYEADVATFVQQVMLPDCPPPYF
ALAHSMGGAVLLRVLHGGARWFDRIVMTAPMIDLPGRTTSWPVRTLIRTLRFVGMGGSYV
PGGNDRLVGSAPFADNPLTSDPVRYARNAAILEEEPTLGIASPTIAWTDAAFRTILSFRA
ASYPSRIRQPVLLLAAGHDRVVSTPAIEEFAYHLRAGSHLVIAGARHEILQEQDRYRAQF
WAAFDAFVPGTPLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggtttcgatccccgccaatcccgtgcccgaagatgtcgtctccggcaccatc
aaggcccgcgatggggtggagctgcgctttgcgcgctgggcgccgcccgcgggccgcaag
ggcacggtctgcatctttgccgggcgcggcgagtgcatcgagaaatatttcgagacggta
catgaactgcgttcgcgcggctttgcagttgcgatggccgactggcgcgggcaggggcat
tccgggcggcagcttggcgattaccgcaagggttatgtccgcagcttcaaggattacgag
gccgacgtcgcgaccttcgtccagcaggtgatgctgccggattgcccgccgccttacttc
gcgctcgcccattcgatgggcggtgcggtgctgctgcgggtgctgcatggcggcgcgcgc
tggttcgaccgcatcgtcatgaccgcgccgatgatcgacctgccgggacgcaccacctcg
tggccggtgcgcacgctgatccgcaccctgcggttcgtcggtatgggcggcagttatgtg
cccggcggcaatgaccggctggtcggcagcgcaccgttcgcggacaatccgctgaccagc
gatccggtgcgctatgcgcgcaatgccgcgatcctggaagaagagccgacgctcggcatc
gcctcgccgaccattgcgtggaccgacgccgcattccgcaccatcctgagttttcgcgcg
gcgagttatccttcgcgcatccgccagcctgtgttgttacttgcggcgggccatgaccgc
gtggtctcgacgcccgcgatcgaggagtttgcctaccacctgcgcgcgggctcgcacctg
gttatcgctggcgcgcgccacgagatcctgcaggagcaggaccgttaccgggcgcagttc
tgggccgccttcgacgcgttcgtgcccggcacgccgttgttctag

DBGET integrated database retrieval system