KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c30120Help
Entry
OCA5_c30120       CDS       T01617                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    OCA5_c30120 (pldB)
Enzymes [BR:ocg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     OCA5_c30120 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3202581..3203525)
Genome map
AA seq 314 aa AA seqDB search
MTLVSIPANPVPEDVVSGTIKARDGVELRFARWAPPAGRKGTVCIFAGRGECIEKYFETV
HELRSRGFAVAMADWRGQGHSGRQLGDYRKGYVRSFKDYEADVATFVQQVMLPDCPPPYF
ALAHSMGGAVLLRVLHGGARWFDRIVMTAPMIDLPGRTTSWPVRTLIRTLRFVGMGGSYV
PGGNDRLVGSAPFADNPLTSDPVRYARNAAILEEEPTLGIASPTIAWTDAAFRTILSFRA
ASYPSRIRQPVLLLAAGHDRVVSTPAIEEFAYHLRAGSHLVIAGARHEILQEQDRYRAQF
WAAFDAFVPGTPLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggtttcgatccccgccaatcccgtgcccgaagatgtcgtctccggcaccatc
aaggcccgcgatggggtggagctgcgctttgcgcgctgggcgccgcccgcgggccgcaag
ggcacggtctgcatctttgccgggcgcggcgagtgcatcgagaaatatttcgagacggta
catgaactgcgttcgcgcggctttgcagttgcgatggccgactggcgcgggcaggggcat
tccgggcggcagcttggcgattaccgcaagggttatgtccgcagcttcaaggattacgag
gccgacgtcgcgaccttcgtccagcaggtgatgctgccggattgcccgccgccttacttc
gcgctcgcccattcgatgggcggtgcggtgctgctgcgggtgctgcatggcggcgcgcgc
tggttcgaccgcatcgtcatgaccgcgccgatgatcgacctgccgggacgcaccacctcg
tggccggtgcgcacgctgatccgcaccctgcggttcgtcggtatgggcggcagttatgtg
cccggcggcaatgaccggctggtcggcagcgcaccgttcgcggacaatccgctgaccagc
gatccggtgcgctatgcgcgcaatgccgcgatcctggaagaagagccgacgctcggcatc
gcctcgccgaccattgcgtggaccgacgccgcattccgcaccatcctgagttttcgcgcg
gcgagttatccttcgcgcatccgccagcctgtgttgttacttgcggcgggccatgaccgc
gtggtctcgacgcccgcgatcgaggagtttgcctaccacctgcgcgcgggctcgcacctg
gttatcgctggcgcgcgccacgagatcctgcaggagcaggaccgttaccgggcgcagttc
tgggccgccttcgacgcgttcgtgcccggcacgccgttgttctag

DBGET integrated database retrieval system