KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c33380Help
Entry
OCA5_c33380       CDS       T01617                                 

Gene name
proB
Definition
glutamate 5-kinase ProB (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ocg01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ocg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3523634..3524827
Genome map
AA seq 397 aa AA seqDB search
MSHSDLRLTDFRRIVIKVGSSLLIDSAAGKVKSAWLAALADDIAALHRAGKDVLVVSSGS
IALGRSRLKLPSGTLKLEESQAAAAVGQIALARIWAKVLDHHGIGAGQILVTLRDTEERR
RYLNARSTISKLLEWRAVPVINENDTVATSEIRYGDNDRLAARVATMTSSDLLILLSDID
GLYTAPPGINPNAKLIPVVESVTADIEAMAGAAGSELSRGGMRTKIEAAKIATSAGTHML
IASGKIDHPLQAIIDGGPCTWFLTPANPVTARKRWIAGSLEPKGVLVIDAGAVKALDAGR
SLLAAGVTRIEGTFARGDAVVVRGPDGHEIGRGLVAYSADNAERIKGKSSAAASKILGLT
GRPEMIHRDDLVVSHHHDNGHNNGSHGVSTPAPEPSA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcattctgatctccggctgaccgatttccgccgcatcgtcatcaaggtcggctcg
tcgctcctgatcgactccgccgcgggcaaggtgaaaagcgcctggctcgccgcgctggcc
gacgacatcgcggcgctgcatcgcgccggcaaggatgtgctggtcgtctcttccggttcg
atcgcgctcggccgctcgcgactgaaactgccgtccggcacgctgaagctcgaggaaagc
caggcggccgccgccgtcggccagatcgcgctggcacggatctgggcaaaagtgctcgac
catcacggcatcggcgccggacagattttggtcacattacgtgacaccgaggaacgccgc
cgttatctcaatgcccgctcgaccatctcgaagcttctggaatggcgcgcggtgccggtc
atcaacgagaacgacaccgtcgcgaccagcgaaatccgctatggcgacaacgaccgtctc
gccgcgcgcgtcgccaccatgacgagctccgatctgctgatcctgctctccgacatcgac
gggctctacaccgccccgcccggcatcaatccgaatgcgaagctgatccccgtggtggaa
tcggtgacggcggatatcgaggcaatggcgggcgcggccgggtccgaattatcgcgcggc
ggcatgcggaccaagatcgaagcggcgaagatcgcaacctccgcaggcacgcatatgctg
atcgcctccggcaagatcgatcatccgttgcaggccatcatcgacggcggcccctgcaca
tggttcctcacaccggcgaatccggtaaccgcgcgcaagcgctggatcgcgggctcgctg
gagccgaaaggtgttctggtgatcgatgccggcgcggtgaaggcgctggacgccgggcgc
agcctcctggccgcaggcgtcacgcgtatcgagggaacgtttgctcgcggcgatgccgtg
gtggtgcgcggtccggacggccacgaaatcggccgcgggcttgtcgcctacagcgccgac
aatgccgagcgcatcaagggaaaatcctcggcggcggcatccaagattttgggccttacc
ggccgcccggaaatgatccaccgcgacgacctcgtggtgtcgcaccatcacgacaatggc
cacaataacggtagccatggcgtctccacgccggctccggagccaagcgcctga

DBGET integrated database retrieval system