KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c33660Help
Entry
OCA5_c33660       CDS       T01617                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    OCA5_c33660
Enzymes [BR:ocg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     OCA5_c33660
   3.1.2  Thioester hydrolases
    3.1.2.-  
     OCA5_c33660
Lipid biosynthesis proteins [BR:ocg01004]
 Fatty acid synthase
  Component type
   OCA5_c33660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3554359..3555066)
Genome map
AA seq 235 aa AA seqDB search
MRVSMPLPYGSFAAAVERRARMFLVAAACLAVAGSSGVMAQTFTPPLKLAVLGDSLTAGY
GLPASAAFPVRLQQALKDKGIATEIVNAGVSGDTASGGRDRLDWSIPEGTQAVLVELGAN
DMLRGVDPKVTRAALDDIITRLKARGIAVMLCGMYAAPNLGEAYGRAFNSIYPELAKKHG
VPLYPFFLDGVTQDAAMKLPDGLHPTAAGVDVIVARILPAVEAFLKELPVTSAVR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtgagagtatccatgcccctgccatatgggagtttcgcagccgcggtcgagaggcgcgca
cggatgtttttggtcgcggcggcctgcctcgccgtggccgggagttctggtgtcatggcg
cagaccttcacgccgccgctcaagctcgccgtgctgggcgattccctcacggccggctat
gggctgccggcctctgccgcatttccggtgcggctgcagcaggcgctcaaggataaaggc
attgcgaccgagatcgtcaacgcgggcgtatcgggtgatacggcctccggtggccgcgac
cggctcgactggtcgatcccggagggcacacaggcggtgctggtcgaactcggcgccaac
gacatgctgcgcggggtcgatccgaaagtcacgcgcgcggccctcgacgacatcatcacc
cggctgaaagcgcgcggcattgccgtgatgttgtgcggcatgtatgcggcgcccaatctc
ggcgaggcgtatgggcgcgcgttcaacagtatctatcccgagctcgcgaagaagcacggc
gtgccgctctatccgttctttctcgatggcgtgacgcaggatgcagcgatgaagctgcct
gatggcctgcatccgactgcggcgggtgtcgacgtcatcgttgcgcggatattgcctgcg
gtggaggcgtttctgaaggaacttccggtcacgtccgcggtgcgttga

DBGET integrated database retrieval system