KEGG   Oligotropha carboxidovorans OM4: OCA4_c00560Help
Entry
OCA4_c00560       CDS       T01967                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain TrpA (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCA4_c00560 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCA4_c00560 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCA4_c00560 (trpA)
Enzymes [BR:oco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCA4_c00560 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(66027..66863)
Genome map
AA seq 278 aa AA seqDB search
MTTRLDTRFADLKKEGRAALVTFLMCGDPDLETSLAIMKALPKAGADVIEIGMPFTDPMA
DGPAIQAAGLRALKAGTTLKKTLDVVRNFRKGEAATPVVLMGYYNPIFIYGVDRFLVDAK
EAGVDGLIVVDLPPEEDEELCLPALKAGVNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
TGITGAAAADDKQVGEAVARIKRHTQLPVCVGFGIRTPEAAARIARHCEGAVVGSALVDA
LRGTLDAEGKAGPNTVSAVTDLVAALAQGVHGVKPVSA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcgcctcgatacccgcttcgccgatctcaagaaggaaggccgcgccgcgctc
gtcaccttcctgatgtgcggcgatcccgatcttgaaacctcgctcgcgatcatgaaggcg
ctgccgaaggcgggcgccgatgtgatcgagatcggcatgccgttcaccgacccgatggcg
gatgggcctgcgattcaggcggcagggctgcgcgcgctgaaggccggcaccacgctgaag
aagacgctcgatgtcgtgcgcaacttccgcaagggtgaagcggcaacgcccgtcgtgctg
atgggctactacaatccgatcttcatctacggtgtcgatcgcttcctcgtcgatgcgaag
gaggcgggcgtcgatgggctcattgtcgtggacttgccgccggaggaagacgaggagctg
tgcctgcccgcgctcaaggccggtgtgaacttcatccggcttgcgacgccgacgaccgac
gacaagcggctgccggccgtgctcgccaacacgtcgggctttgtctattacgtctcgatc
accggcatcaccggcgccgccgcagccgacgacaagcaggtcggcgaagcggtggcgcgg
atcaagcgtcacacccaattgccggtctgcgtcggcttcggcattcgcacgcccgaggcg
gcggcccgcatcgcacgccattgcgagggcgccgtcgtcggctctgcgcttgtcgatgcg
ctgcgcggaacgctcgacgccgagggcaaggccgggccgaacacggtatccgccgtcacc
gacctggtcgctgcgctggcacagggcgtccatggcgtcaaaccagtgtcggcgtaa

DBGET integrated database retrieval system