KEGG   Oligotropha carboxidovorans OM4: OCA4_c00570Help
Entry
OCA4_c00570       CDS       T01967                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00260  Glycine, serine and threonine metabolism
oco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oco01100  Metabolic pathways
oco01110  Biosynthesis of secondary metabolites
oco01130  Biosynthesis of antibiotics
oco01230  Biosynthesis of amino acids
Module
oco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCA4_c00570 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCA4_c00570 (trpB)
Enzymes [BR:oco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCA4_c00570 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEI01217
Position
complement(66860..68077)
Genome map
AA seq 405 aa AA seqDB search
MSLPKPNSFRAGPDERGHFGTFGGRFVAETLMPLILDLEKAYAAAKADPSFQKEMNGYLK
DYVGRPSPLYFAERLTEHLGGAKIYLKREELNHTGSHKVNNVLGQIMVARRMGKKRIIAE
TGAGQHGVATATLCARFGLECIVYMGAVDVARQEPNVIRMEMLGAKVVPVQSGTRTLKDA
MNDALRDWVTNVATTFYCIGTVAGPHPYPAMVRDFQSVIGHETREQMMAAEGRLPDSLVA
CIGGGSNAMGLFHPFLDEPAVEIFGVEAAGHGLTNLHAASLAGGRPGVLHGNRTYLLMNE
DGQIQDAHSISAGLDYPGIGPEHAWLHETGRVTYLSATDEEALAAFQLLSRLEGIIPALE
SAHAIAKLSQLAPKRPRDHLMVVNLSGRGDKDVPQVGDILRGRKS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttccaaaacccaattccttccgcgcaggccctgatgagcgtggtcacttcggc
accttcggcggccgcttcgtcgccgaaacactgatgccgttgatcctcgatctcgagaag
gcctatgccgcggcgaaggccgatccgtcatttcagaaggaaatgaacggctatctcaag
gattatgtcggccgtccgtcgcccctgtatttcgccgaacgcctcaccgagcatctcggc
ggtgcgaagatttatctcaagcgcgaagagctgaaccacaccggctcgcacaaggtgaac
aacgtgctcggccagatcatggtcgcgcgccgcatgggcaagaagcgcatcatcgcagag
accggcgcggggcagcatggcgttgccaccgcgacgctgtgcgcgcgcttcgggctcgaa
tgtatcgtgtacatgggtgcggtcgatgttgcgcggcaagagccgaacgtcatccgtatg
gagatgctgggcgccaaggtggtgccggtgcagtccggcacgcgcacgctgaaagatgcg
atgaacgatgcgctgcgcgattgggtgacgaacgtggcgaccacgttctattgcatcggc
acggtggcgggcccgcatccctatcctgcgatggtgcgcgacttccagtcggtgatcggc
catgagacgcgcgagcagatgatggcggcggaaggccgcctgccggattcgctggtcgcc
tgcatcggcggcggctccaatgcgatggggctgtttcatccgttcctcgatgagcctgcc
gtcgagattttcggcgtcgaggccgcgggccatgggctgacgaatttgcacgctgcctcg
ctcgcgggcggtcgccccggcgtgctgcacggcaatcgcacgtatctcctgatgaacgag
gacggccagattcaggacgcgcattcgatttcggcgggcctcgattatcccggcatcgga
ccggagcatgcctggctgcacgagaccggccgcgtgacgtatctgtccgcgaccgacgag
gaagcgctcgccgcgttccagttgctgtcgcggctcgaaggcatcattccggcattggag
tcggcgcatgcgatcgcgaagctgtcgcagctcgcgccgaagcggccgcgcgatcacctg
atggtcgtcaatctctccggccgtggcgacaaggacgtgccgcaggtcggcgatattctg
cgggggcgcaagtcatga

DBGET integrated database retrieval system