KEGG   Oligotropha carboxidovorans OM4: OCA4_c01990Help
Entry
OCA4_c01990       CDS       T01967                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCA4_c01990
Enzymes [BR:oco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     OCA4_c01990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216940..217704
Genome map
AA seq 254 aa AA seqDB search
MSILVMRPFPDNEATAAALRDEGYSVLLSPALRFEPVPLREEPDALPYDAILATSANALR
GIEGKPILERLCETKLFAVGDATAQIARNAGFRDVESAAGDAVALIALVEARMRGKGRIC
YLAGADVSRDLGADLGAQGYSVTTLTTYRMIPLPHFSEAVEAAFAAGEVEAVLHYSRRSA
RAFVAAVQAAGLEISALALPQFCISNVVGTVLQEAGAARVRVAAAPDEPAMFEALQRAIA
PKRPSRPKTKSGKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcctggtgatgcggccttttcctgacaacgaggcgaccgcggccgcattgcgg
gatgagggatatagtgtgttgctgtcgccggcgctgcggtttgagccggtgccgctgcgc
gaagagcctgacgcacttccctacgatgcgattcttgcgaccagcgccaatgcgctacgc
ggcatcgagggaaaaccaatcctggagcgactgtgcgagacaaagctgttcgctgtcggc
gatgcgacggcgcaaatcgcgcggaacgcgggctttcgcgatgtcgagagcgcagcgggc
gatgcggtagcgctgatcgcgctggtcgaggcgcggatgcgtggcaagggccggatctgc
tatctcgcgggggccgatgtgagccgcgacctcggtgccgatctcggcgcacaaggctac
agcgtgaccacgctcacgacttaccgcatgattccgcttccacatttttccgaagcggtt
gaggcggcgtttgcggccggagaggtcgaggcagtgctgcattattcgcggcgcagcgcg
cgggcattcgtcgccgcggtgcaggcggcaggccttgagatttccgcgctggcgctgccg
cagttctgcatctcgaacgtggtcggcacggtgttgcaggaggccggcgccgcgcgggtg
cgggtcgcggcggcgcccgatgagcctgcgatgttcgaggcattgcagcgtgcgatcgcg
ccgaagcggccatcgcggcccaaaacgaaatctggtaagctgtag

DBGET integrated database retrieval system