KEGG   Oligotropha carboxidovorans OM4: OCA4_c02620Help
Entry
OCA4_c02620       CDS       T01967                                 

Gene name
folE1
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OCA4_c02620 (folE1)
Enzymes [BR:oco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     OCA4_c02620 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277272..277904
Genome map
AA seq 210 aa AA seqDB search
MSNLSNVQVLERDRKAEEESARPDRAEVEAAVRTIIRWAGDDPKRDGLIETPSRVARAFE
EFFIGYSQNPTTILQKTFEEIDGYDEMITLRAVRFESHCEHHMAPIVGKAWVAYIPNGRV
VGISKLARVVEVYAKRLQIQEKMTAQIANTINEVLKPQGVAVLIKAQHHCMTTRGIHKPG
TDLVTSRMLGCFRDNATTRQEFLSMTTDPE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatctatcgaatgttcaggtgctcgagcgcgatcgcaaggcggaagaggagtcc
gcgcggccggatcgcgccgaggtggaggctgcggtccgcaccatcatccgctgggcgggc
gatgatccgaagcgtgatggcctcattgagacgccgagccgcgttgcgcgcgctttcgag
gagtttttcatcggctacagccagaatccgacgaccatcctgcagaagaccttcgaggaa
atcgacggctatgacgagatgatcacgttgcgtgccgtgcgcttcgaaagccattgcgag
caccacatggcgccgatcgtcggcaaggcctgggtggcctacattccgaacggacgcgtg
gtcggcatcagcaagctcgcgcgggtggtcgaggtctatgccaagcggctgcagatccag
gaaaagatgacggcacagatcgccaacaccatcaacgaggtgttgaagccgcagggtgtc
gccgtgctgatcaaggcgcagcatcattgcatgacgacgcgcggcatccacaagcccggc
accgatctcgtcaccagccgcatgctcggctgcttccgcgacaatgccacgacgcggcag
gaatttttgagcatgacgaccgaccccgaataa

DBGET integrated database retrieval system