KEGG   Oligotropha carboxidovorans OM4: OCA4_c05800Help
Entry
OCA4_c05800       CDS       T01967                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCA4_c05800 (algC)
   00030 Pentose phosphate pathway
    OCA4_c05800 (algC)
   00051 Fructose and mannose metabolism
    OCA4_c05800 (algC)
   00052 Galactose metabolism
    OCA4_c05800 (algC)
   00500 Starch and sucrose metabolism
    OCA4_c05800 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    OCA4_c05800 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    OCA4_c05800 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OCA4_c05800 (algC)
Enzymes [BR:oco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     OCA4_c05800 (algC)
    5.4.2.8  phosphomannomutase
     OCA4_c05800 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
607279..608778
Genome map
AA seq 499 aa AA seqDB search
MFPKPKAELKPNTYAYESEPMVKATGFREYDARWLFGKEINLMGVQALGMGLGTMIGEMS
VKQEIVVGHDFRGYSASIKYALISGLLAAGCKVHDIGLAVTPMAYFAQFDLDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMTRLKEIVLGAAFKLQPAGGYQFHENFPARYIADL
TKRKPFSRRIRAVVACGNGTAGAFAPQVLEKLGVDVIPLDTELDHTFPKYNPNPEDLEML
HAIRDAVLEHKADVGLGFDGDGDRCGVVDDTGEEIFADKVGVMLARDMSALHKNAQFVVD
VKSTGLFVTDPVLSRQGAQASYWKTGHSYMKRRTHELGALAGFEKSGHFFFNAPFGRGYD
DGLVSAIAICEMLDHAPGKKMSDLKNALPKTWSSPTMSPHCADEAKYGIVDKVVKHFETA
KAKGDKVAGQPIRDLVTVNGVRVTCEDGSWGLVRASSNKPELVVVVESPVSEKRMREMFE
AMDSVLRTHPEVGEYNQKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgaagccgaaagccgagctgaagcccaatacctacgcctatgaatccgagccg
atggtgaaggccaccggcttccgcgaatacgatgcgcgatggctgttcggcaaggaaatc
aacctgatgggcgttcaggcgctcggcatgggcctcggcaccatgatcggcgagatgagt
gtgaagcaggagatcgtggtcggccacgacttccgtggctactcggcctcgatcaaatac
gcgctgatctcgggcctgctcgcggccggctgcaaggtgcacgacatcggccttgcggtg
acgccgatggcctatttcgcgcagttcgatctcgacgtgccttgcgtggcgatggtcacg
gcctcgcataacgacaatggctggaccggcgtgaagatgggcgcgaaccggccgctcacc
ttcggtcccgacgagatgacgcggctgaaggagattgtgttgggcgcggccttcaagctg
cagccggccggtggctatcagtttcacgagaatttcccggcgcgctacatcgcggacctc
accaagcgcaagccgttctcgcgccgcatccgcgcggtggtcgcctgcggcaatggcacg
gcgggcgcattcgcaccgcaggtgctggaaaagctcggcgtcgacgttatcccgctcgat
accgaactcgaccacaccttcccgaaatacaatccgaatcctgaagaccttgagatgctg
catgcaatccgcgacgcggtgctcgaacacaaggccgatgtcggcctcggcttcgacggc
gatggcgatcgctgtggcgtggtcgacgacaccggtgaggaaatcttcgccgacaaggtc
ggcgtgatgctggcgcgcgatatgtcggcattgcacaagaacgcgcagttcgtcgtcgac
gtgaagtcgaccggattgttcgtcaccgatccggtgctctcgaggcagggcgctcaggcg
agttactggaagaccggccactcctacatgaagcgccgcacgcatgagcttggcgcgctg
gcgggcttcgagaagtccggccacttcttcttcaatgcgccgttcgggcgtggctatgac
gacggtctcgtctccgcgatcgcgatctgcgagatgctcgaccacgcgcccggcaagaag
atgtcggacctgaagaacgcgttgccgaaaacctggtcgtcgccgacgatgtcgccgcac
tgcgcggacgaagcgaagtacggcatcgtcgacaaggtggtgaagcatttcgagacggcg
aaggcgaagggcgacaaggtcgccggtcagccgatccgcgatctcgtcacagtgaacggc
gtgcgcgtcacctgcgaggacggaagctggggccttgtgcgcgcatcatcgaacaagccc
gaacttgtcgtggtggtggaaagcccggtctccgagaagcgcatgcgcgagatgttcgag
gcgatggacagcgttctgcgcacccatcccgaagtcggcgaatacaatcagaagatttaa

DBGET integrated database retrieval system