KEGG   Oligotropha carboxidovorans OM4: OCA4_c06890Help
Entry
OCA4_c06890       CDS       T01967                                 

Gene name
fadA1
Definition
(GenBank) 3-ketoacyl-CoA thiolase FadA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCA4_c06890 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    OCA4_c06890 (fadA1)
   00640 Propanoate metabolism
    OCA4_c06890 (fadA1)
   00650 Butanoate metabolism
    OCA4_c06890 (fadA1)
  Lipid metabolism
   00071 Fatty acid degradation
    OCA4_c06890 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    OCA4_c06890 (fadA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCA4_c06890 (fadA1)
   00310 Lysine degradation
    OCA4_c06890 (fadA1)
   00380 Tryptophan metabolism
    OCA4_c06890 (fadA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCA4_c06890 (fadA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCA4_c06890 (fadA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCA4_c06890 (fadA1)
Enzymes [BR:oco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCA4_c06890 (fadA1)
Exosome [BR:oco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCA4_c06890 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
725124..726311
Genome map
AA seq 395 aa AA seqDB search
MSDAVIVSTARTPIGKAYRGALNATEGATLFAHAIKAAVERAQLDPAEVEDVVMGAALQQ
GATFANIARKALLRAGLPVTVAGTTVDRQCASGLQAIANAARSVLFDGVGIAVAGGGESI
SLVQNDKMNMFHAVDPALQEIKPDIYMSMLDTAEVVAKRYGISRERQDEYALESQRRIAA
AQQAGRFKDEIAPISTTMGVLDKASGEVSFKDVTLSQDEGPRPDTTAEGLAALKPVKGEG
FTITAGNASQLSDGASAVVVMSDKTAAQRNLKPLGIFRGMVSVGCEPDEMGIGPVFAVPR
LLKRHGLSVDDIDLWELNEAFAVQVVYCRDKFGLDPEKLNVNGGAIGVGHPYGMTGARLA
GHVLIEGRRRKAKYAVVTMCVGGGMGSAGLFEIVQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgccgtcatcgtttccacagcccgcacgccgatcggcaaggcctatcgtggt
gcactgaatgccactgaaggcgcgacgctgttcgcacatgcgatcaaagccgcggtggag
cgggcgcagctcgaccctgccgaggtggaggacgtggtgatgggtgccgcgctgcagcaa
ggggcgacctttgccaacatcgcacgcaaggcactgctgcgtgcgggtctgcccgtcacg
gtcgccggcaccacggtggaccgtcagtgtgcatcgggtctacaggcgattgcgaatgcg
gcgcgctcggtgctgttcgatggcgtcgggatcgcggtggcgggcggcggcgaatcgatc
agcctcgttcagaacgacaagatgaacatgtttcatgcggtcgatccggcgctgcaggag
atcaagcccgatatttacatgtcgatgctcgacaccgccgaggtggtggcgaagcgctac
ggcatttcgcgcgagcggcaggatgagtacgcgctggaaagccagcgccgcatcgccgcc
gcgcagcaggcgggccggttcaaggatgagatcgcgccaatttcaacgacaatgggcgtg
ctcgacaaggcaagcggcgaggtgtcgttcaaggacgtgacgctttcgcaggatgaaggc
ccgcgacccgatacaacggcggagggcctggccgcgctgaagccggtgaagggcgaaggc
ttcaccatcaccgccggcaatgcgagtcagctctccgatggcgcgagcgccgtggtggtg
atgagcgacaagacggccgcgcagcgcaacctgaagccgctcggtatcttccgtggcatg
gtgtcggtcggctgcgagccggacgagatgggcatcggcccggtgttcgcggtgccgcgg
cttctcaagcgtcacggcctgagcgtggatgatatcgatctgtgggaattgaacgaggca
ttcgcggtgcaggtcgtctattgccgcgacaagttcgggctcgatcccgagaagctcaac
gtcaacggcggcgccatcggcgtcggccacccctatggcatgaccggcgcgcggcttgcg
ggccatgtgctgatcgaagggcggcggcgcaaggcgaaatacgcagtggtgacgatgtgc
gtcggcggcggcatgggctcggccggtctgttcgagatcgtgcagtag

DBGET integrated database retrieval system