KEGG   Oligotropha carboxidovorans OM4: OCA4_c06970Help
Entry
OCA4_c06970       CDS       T01967                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    OCA4_c06970 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCA4_c06970 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737182..737694
Genome map
AA seq 170 aa AA seqDB search
MDSFELNKIMGAILGTCLVLLVTNFAAQAIFAPQKPEKPGFEIAVKEDASGGAEATKAAE
VPIEQLLANASVEKGQAASKKCAACHTFDKGGPNKVGPNLFGVIDEPKGEGRGFNFSAAM
KAKGGSWTIEDLNQFIKSPKGFVPGTAMGFAGISKDSERADLIAYMKTLK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggactctttcgaactcaacaagatcatgggtgcgattctcggcacttgccttgttctg
ctggtcacgaactttgccgcacaggcgatcttcgcaccgcagaagccggaaaagccgggc
tttgaaattgccgtgaaggaagatgcaagcggtggcgccgaggcgaccaaggcggctgag
gtgccgatcgagcagctgctcgcgaacgcgtcggtcgagaagggccaggcggcttccaag
aagtgcgcagcctgccacaccttcgacaagggcggcccgaacaaggtcggcccgaacctc
tttggcgtcatcgatgagccgaagggcgagggccgcggcttcaacttctccgctgccatg
aaggcgaagggcggaagctggaccatcgaggacctcaaccagttcatcaagagcccgaag
ggtttcgtcccgggcaccgcgatgggttttgccggcatcagcaaggacagcgagcgcgcc
gacctgattgcctatatgaagaccctgaagtaa

DBGET integrated database retrieval system