KEGG   Oligotropha carboxidovorans OM4: OCA4_c07390Help
Entry
OCA4_c07390       CDS       T01967                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase BdhA (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:oco00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:oco00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
784157..784945
Genome map
AA seq 262 aa AA seqDB search
MSSLAGKAAVVTGSTSGIGLAYARALARAGANIVLNGMGEPADIEKERSGIEREFGVKAV
HSPADMTRPDEIEQMVRLGEKTLGSVDILINNAGIQFVSPVEEFPLDKWDAIIAINLSSA
FHAIRAAVPGMKARGWGRIINTASAHSLVASPFKSAYVAAKHGIAGLTKTVALELATHKI
TCNAISPGYVWTPLVERQVPDTMKARNMTKEEVIKDVMLLAQPTKEFVTVEQVAALAVYL
CGDEASQITGANLSIDGGWTAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagttcattggcaggcaaggccgcggtcgtcaccggatcgaccagcggcatcggattg
gcatatgcgcgggcgctcgcgcgggccggcgcgaatatcgtgctgaacggcatgggcgag
cccgccgatatcgagaaggagcggtcggggatcgagcgcgagttcggcgtcaaggcggtt
cattcgcccgccgatatgaccaggcccgatgagatcgaacagatggttcggctcggcgaa
aagacgctcggttcggtcgatattctcatcaacaatgcgggcatccagttcgtctcgccg
gtcgaggaatttccgctcgacaaatgggacgcgatcatcgccatcaatttgtcatcggcg
tttcatgcaatccgcgccgcggtgccaggcatgaaggcgcgcggttggggccgcatcatc
aacaccgcatcggcgcactcgctggtggcctcgccgttcaagtcggcttacgtcgcggcg
aagcacggcattgccggtctcaccaagacggtcgcgctcgaacttgcgacccacaagatc
acctgcaacgccatcagccccggttatgtctggacgccgcttgtcgagcggcaggtgccc
gacaccatgaaggcgcgcaacatgaccaaggaagaggtcatcaaggacgtgatgctgctg
gcgcagccgaccaaggagttcgtcaccgtcgagcaggtcgcggcgcttgcggtctatctc
tgcggcgacgaggcgagccagatcaccggcgccaatctctcgatcgacggcggctggacc
gcggcttaa

DBGET integrated database retrieval system