KEGG   Oligotropha carboxidovorans OM4: OCA4_c07610Help
Entry
OCA4_c07610       CDS       T01967                                 

Definition
peptidase M20 family protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCA4_c07610
  Amino acid metabolism
   00300 Lysine biosynthesis
    OCA4_c07610
Enzymes [BR:oco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     OCA4_c07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
810425..811645
Genome map
AA seq 406 aa AA seqDB search
MAMTEEQTFLDKIDAEISAERDNLIAFCGRLVREPSESPPGETLGVSKVVQAYLGEHGVA
SEVVACDPNAPNLVAHLGEGAGRHIVYNAHMDTMRPGDESCWSVPILELTRKDGRLYGLG
MGNMKGGLAAMCLATAVLARHRKELPGRLTMTAVCDEVMFGDRGAVHLLAARPDVHGDYM
ISGEGPGFMNMAPAEKGLLWLDVETTGDGGHSSRAMNGETAVGKLVALLTKADALNDVYA
EIPAEINGVTGGPENTGLRLSFSAGVVRADGVRSLIATSARAEIDVRLPPGITGKEIEQR
VRALGSTDGISVRAVKGWDASWTSLSNPVVTEMMAAATTVRGARPDMVVRLPGSDARRWR
DLGVPSVCYGPQPTLSAGVDDYAEEQAVLDCARVYARAALRLMKHG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgacggaggagcaaacctttctcgacaagatcgacgcggaaatttccgcggag
cgtgacaacctgatcgcgttctgcggccggctggtgcgcgagccgagcgaaagcccaccc
ggcgagacgctcggtgtctccaaggtggtgcaggcgtatcttggcgaacacggcgtcgcg
tccgaggtggtcgcgtgcgatccgaatgcgccgaatctcgtggcgcatctcggcgagggg
gcaggacgacatatcgtctacaacgcgcatatggatacgatgcgccccggcgatgaaagc
tgctggagcgtgccgatccttgagctgacgcggaaggatggccgcctttacgggctcggc
atgggcaatatgaaaggcggcctggccgcgatgtgcctcgccaccgccgttctcgcgcgg
catcgcaaggaactgcccggccgtctgacgatgacggccgtctgcgacgaggtgatgttc
ggcgaccgtggtgcggtgcatcttcttgctgcgcgccccgatgtgcatggcgattacatg
atcagcggcgaagggccggggttcatgaacatggcgcccgccgagaaggggctgctgtgg
ctcgatgtcgagaccacgggtgatggcggtcattcctcgcgcgcgatgaatggcgagacg
gcggtcggcaagctcgtggcgctgctcaccaaggccgatgcgctgaacgatgtctatgcc
gaaattcccgccgagattaatggcgtgacgggtgggccggagaatactggcctgcggttg
tcgttcagcgcgggcgtcgtgcgtgccgatggcgtgcgcagccttatcgccacctcggcg
cgggccgagatcgatgtgcgtttgccgcccggcatcactgggaaggagatcgagcagcgc
gtgcgcgcactcggctccacggatggcatcagcgtgcgcgcggtgaaaggctgggacgca
agctggacctcgttgtccaatccggtcgtcacggagatgatggcggctgccaccacggtg
cggggcgcgcggcccgatatggtcgtgcgtctgccgggcagcgatgcacggcgctggcgc
gacctcggcgtgccgtccgtctgttacggtccgcagccgacgctctcggctggtgtcgac
gattacgccgaggagcaagcggtgcttgactgcgcccgcgtctacgcgcgcgccgcgttg
cggctgatgaagcacggatag

DBGET integrated database retrieval system