KEGG   Oligotropha carboxidovorans OM4: OCA4_c12500Help
Entry
OCA4_c12500       CDS       T01967                                 

Gene name
adh1
Definition
Zn-dependent alcohol dehydrogenase Adh (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OCA4_c12500 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCA4_c12500 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    OCA4_c12500 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    OCA4_c12500 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OCA4_c12500 (adh1)
   00626 Naphthalene degradation
    OCA4_c12500 (adh1)
Enzymes [BR:oco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OCA4_c12500 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1334067..1335050
Genome map
AA seq 327 aa AA seqDB search
MRAMVLSGPGAELKMADLPDPVPQPGQVRVRVGACGVCRTDLHVMDGELPHIKYPIIPGH
EIVGRVDAIGPGVSNHCLGERVGVPWLGHTCGECFYCRSEMENLCDDPLFTGYTRDGGFA
THTVVDADFAFPLEEEGPDEAVAPLLCAGLIGWRSLVMAGDAKRLGIYGFGAAGHIVAQV
AKWQGRSIYAFTRGDDAAAQAFARELGAVWAGSSDALPPEPLDAAILYAPVGSLVPAALR
AVRKGGRVVCAGIHMSDIPSFPYSLLWEERQIVSVANLTRRDGIEFLRIVPQAKVQTHTT
VFQLGRANEALAMLRQGSLVGAAVLKP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggttctgagcggaccgggagcggaactcaagatggccgatctgccggat
cctgttccacagcccggccaggtgcgcgtgcgggtcggtgcctgtggcgtctgccgaacc
gatcttcacgtcatggacggcgagttgccgcatatcaaatatccgatcattcccggacat
gagattgtcgggcgcgtggacgcgatcggacctggcgtctccaaccattgtcttggcgag
cgggtcggtgttccctggcttggtcacacctgcggggagtgtttttactgcaggagcgag
atggaaaatctttgcgatgatcctctgttcaccggctatacgcgggatggcggatttgcg
acgcacacggttgtcgacgcagatttcgcgtttccgttggaagaggagggacctgacgag
gcggttgccccgttgctttgcgccggcctgatcggctggcgctcgctggtcatggccggt
gatgcaaagcgtcttggaatatatggttttggggcagccggccatatcgtggcgcaagtg
gcgaagtggcaaggccggtcgatttatgcctttacccgcggcgatgatgctgcagcgcaa
gcctttgcgagagagttgggcgcggtatgggccggttcctccgacgcgttgccgccggag
cctctcgatgccgcgatcctgtatgcgcctgtcggctctcttgttcctgcggcgctgcgc
gcggtgcggaaaggcggccgtgtcgtgtgcgccggcattcacatgagcgatatcccatcc
tttccgtacagcttgttatgggaagaacgacagatcgtctcggtcgcaaacctgacccgt
cgcgacgggatcgagtttctcagaatcgtgccccaagccaaggtccagacgcataccacg
gtcttccaacttgggcgcgccaacgaggcgcttgccatgttgcgacaaggaagtctggtc
ggggcggccgtcctcaagccttga

DBGET integrated database retrieval system