KEGG   Oligotropha carboxidovorans OM4: OCA4_c14230Help
Entry
OCA4_c14230       CDS       T01967                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oco00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1547537..1548391)
Genome map
AA seq 284 aa AA seqDB search
MTARSSTFGTSASTRHDILPALLGKPHPLVMGVLNVTPDSFSDGGRFLDPATALAQAERM
VAEGADILDVGAESTRPYGSVRISEEDELARLRPILPALTRLGVPISIDTMKAGVAAWAL
DQGAAIANDVWGLHRDPAMARLAAARGVPVVVMHNRDAADPAIDIMDDIAAFFTRSLAIA
DEAGLPRERIVLDPGIGFGKTAEQSMIALARLGELGRFGLPILVGASRKRFIASISPSEP
DQRIGGSLAAHLIAVQNGARIIRAHDVHETVQALRVAAAIGDKR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgctcctcaacctttggcacttcagccagcacccggcacgacatattgccc
gcgctgctgggaaagccgcatccgctggtgatgggggtgctcaatgtgacgccggattcc
ttctccgacggcggccgttttctcgatcccgccaccgcgcttgcccaggccgagcggatg
gtggctgaaggcgccgacattctcgatgtcggagcggaatcgacccgtccctacggctcg
gtccggatttcggaagaggacgaactggcgcggctgcggcctattctgcccgccctcacc
cggctcggcgtgccgatctcgatcgacaccatgaaggccggcgtcgccgcctgggcgctc
gatcagggtgccgcgattgcaaacgacgtctgggggctgcaccgcgaccccgcgatggcg
cgccttgcggccgcacgtggcgtgcccgtcgtggtgatgcacaatcgcgatgccgccgac
ccggccatcgacatcatggacgacatcgcggccttcttcacccgctcgctcgcaatcgcc
gacgaggccggcctgccgcgcgagcgcatcgtgctcgatcccggcatcggcttcggcaag
accgccgagcaaagcatgatcgcgctggcccgccttggcgaactgggccggttcgggttg
cccattctggtgggcgcttcgcgcaagcgcttcatcgccagtatctcgccatccgaacca
gatcagcgcatcggcggctctcttgcggcgcatctcatcgcggttcagaatggtgcccgc
atcattcgcgcgcatgacgtccatgagaccgtccaggcgctgcgcgtggcggctgcaatc
ggggacaagcggtga

DBGET integrated database retrieval system