KEGG   Oligotropha carboxidovorans OM4: OCA4_c16800Help
Entry
OCA4_c16800       CDS       T01967                                 

Gene name
gmk
Definition
guanylate kinase Gmk (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:oco00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1818287..1818937
Genome map
AA seq 216 aa AA seqDB search
MSGNARTGERRGLMFVLSSPSGAGKSTLSRMLVENTRGLRMSISATTRPMRPGEVEGEHY
YFIDKPRFDAMVLAGEFLEHAPVFDNHYGTPRAPVERALAAGEDVLFDIDWQGTQQLREK
ARADVVSVFILPPSASDLERRLHTRAQDSDAVIRGRMDRATHELSHWAEYDYVVINNDLG
RAFGEIETILRAERLKRERQTGLSTFVRDLQTQLKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaatgcacgcacgggagagcggcgtggcctgatgttcgtgctgtcctcaccc
tcgggcgcgggcaagtcgacgctgtcgcggatgctggtcgagaatacgcgcggtctgcgg
atgtcgatctcggcgacgacgcggccgatgcggccgggcgaagtcgagggcgagcattat
tacttcatcgacaagccgcgcttcgacgcgatggtgcttgcgggcgaattcctcgaacat
gcgccggtgttcgacaatcattacggtacgccgcgcgcgccggtcgagcgggcgctcgca
gccggcgaggacgtgctgttcgacatcgactggcagggtacgcagcaattgcgcgagaag
gcacgggccgatgtcgtcagtgtcttcatcctgccgccgtcggcatctgacctcgaacgc
aggctgcacacgcgcgcgcaggattccgacgcggtgatccgcgggcggatggatcgtgcg
acccatgaactgagccactgggccgaatacgattatgtcgtgatcaataacgatctcggc
cgggcgtttggcgagatcgagacgatcctgcgcgccgagcggctgaagcgcgaacgccag
accggcctttcgactttcgtgcgcgatctgcagacccagttgaagaagtaa

DBGET integrated database retrieval system