KEGG   Oligotropha carboxidovorans OM4: OCA4_c17290Help
Entry
OCA4_c17290       CDS       T01967                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oco01100  Metabolic pathways
oco01110  Biosynthesis of secondary metabolites
oco01130  Biosynthesis of antibiotics
oco01230  Biosynthesis of amino acids
Module
oco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCA4_c17290 (trpC)
Enzymes [BR:oco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     OCA4_c17290 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEI02867
Position
complement(1876812..1877609)
Genome map
AA seq 265 aa AA seqDB search
MSDILQKIERYKREEIASAKAAHPQAEVEAAARHAPALRGFAKAIRDRLAHKQFALIAEI
KKASPSKGLIRADFDPPALARAYEAGGATCLSVLTDTPSFQGHLDFMVAARAATSLPVLR
KDFMYDTYQVMEARAHGADCILIIMAALDDAAARDIEAAALDLGMDVLLEVHNEPELERA
LKLRSKLLGINNRNLRTFETTLATSEALAASVPNDRIMVGESGIFTPADIARLARVGIET
FLVGESLMRQTDVTSATRTLLAKAS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgacatcctgcaaaagatcgaacgctacaagcgcgaggaaatcgcctctgccaag
gctgcgcatccgcaggccgaggtcgaggcggccgcgcgccatgcgccggccctgcgcggg
tttgcgaaggcgatccgcgaccggcttgcgcacaagcaattcgcgctgattgccgagatc
aagaaggcgtcgccttcaaaaggcttgatccgcgccgatttcgatccgcctgcgctggcg
cgcgcctatgaggcgggtggcgcgacctgcctgtccgtgctcaccgacacgccctcgttt
cagggccacctcgattttatggtggcggcgcgcgcggccacctcactgccggtgctgcgc
aaggacttcatgtacgacacctatcaggtgatggaggcgcgtgcgcatggcgccgactgc
atccttatcatcatggcggcgctcgatgacgccgccgcacgcgacatcgaggctgcagcg
ctcgacctcggcatggatgtgctgctcgaagtacacaacgaacccgagcttgagcgcgca
ttgaagctgcgctcaaagcttctcggcatcaacaaccgcaacctgcgcaccttcgagacc
acgcttgcgaccagcgaggcgctcgccgcctccgtaccgaatgatcgcatcatggtcggc
gagagcggcatcttcacgcccgccgacattgcgcggctggcccgcgtcggcatcgagacg
ttcctcgtcggcgaaagcctgatgcggcagaccgacgttacatccgccacccgcaccctg
cttgcgaaggcctcatga

DBGET integrated database retrieval system