KEGG   Oligotropha carboxidovorans OM4: OCA4_c17320Help
Entry
OCA4_c17320       CDS       T01967                                 

Gene name
tpiA
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCA4_c17320 (tpiA)
   01230 Biosynthesis of amino acids
    OCA4_c17320 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCA4_c17320 (tpiA)
   00051 Fructose and mannose metabolism
    OCA4_c17320 (tpiA)
   00562 Inositol phosphate metabolism
    OCA4_c17320 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCA4_c17320 (tpiA)
Enzymes [BR:oco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OCA4_c17320 (tpiA)
Exosome [BR:oco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OCA4_c17320 (tpiA)
  Exosomal proteins of bladder cancer cells
   OCA4_c17320 (tpiA)
  Exosomal proteins of melanoma cells
   OCA4_c17320 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1880765..1881520
Genome map
AA seq 251 aa AA seqDB search
MPGKIRPLIAGNWKMNGLKASLGELAAIGKGAGEVWRRVDLLICPPATLIFPAAAAMIGS
KVAIGGQDCHAEASGANTGDISAEMLADAGATYVIVGHSERRTDHGETDAVVRAKAEAAW
RAGLVAIVCVGETRAERDAGRAAEVVGRQLDGSVPDGARAANLVVAYEPVWAIGTGLTPT
SQDIEEIHAVIRQNLTGRFKAEGEGVRLLYGGSLKPANAAEILALANVNGGLIGGASLKA
ADFLAIAEACP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcaagatccgaccgctgatcgcggggaactggaagatgaacggcctcaaggcc
tcgctcggtgaacttgcggcgatcggcaagggtgcaggcgaagtctggcgcagggtcgat
cttctgatctgcccgcctgcgacgctgatcttcccggcggccgctgccatgatcggatcg
aaggtcgcgatcggcgggcaggactgtcacgctgaggcttccggcgccaataccggcgat
atctccgccgagatgctggccgatgcgggggccacgtacgtcatcgtcgggcactccgag
cgccgcaccgaccatggcgagaccgacgcggtggtgcgggcgaaggcggaggctgcctgg
cgcgccgggcttgtcgccatcgtctgtgtcggcgagacgcgggccgagcgcgatgcgggc
cgggccgccgaggtagtcggccgccagcttgatggttcggttcccgacggggcgcgtgcg
gccaatctggtcgtggcctacgagccggtctgggcgatcggaaccgggctcacgccgacc
tcgcaggatattgaagaaatccatgccgttatccggcaaaacctgacaggccggtttaag
gcggaaggcgagggtgtgcgccttctttatggcgggtcgctgaagcctgccaacgccgcc
gaaatcctcgcgctggccaacgtcaatggcggcctgattggtggggcgagcctcaaggcg
gccgacttccttgcgatcgcggaggcctgtccttaa

DBGET integrated database retrieval system