KEGG   Oligotropha carboxidovorans OM4: OCA4_c17610Help
Entry
OCA4_c17610       CDS       T01967                                 

Gene name
nagZ
Definition
beta-hexosaminidase NagZ (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:oco00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:oco00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1910398..1911420
Genome map
AA seq 340 aa AA seqDB search
MAVRAFITGVSGPVLTDGERAFLREEQPWGFILFKRNVETPLQVAALIDDLRATVGRPNA
PVLIDQEGGRVQRLGPPHWARYPAGAVFGALYDRNPEQGLRAAWLSSRLIASDLAGLGIS
VDCLPLADLPVEGADAVIGDRAYGTTPDKVVALARAVANGLQDGGIIPVLKHIPGHGRAT
ADSHLRLPTVDTPRAELERTDFVPFTQLADLPMAMTAHVVFSGLDAAQPATTSATIISQV
IRGAMNFQGLLMSDDVSMNALSGTLAERTRASLKAGCDVALHCNGKMDEMRAVASETPEL
AGEALKRAERALAARKAPQPFDREAGRAELDELIAQAGIA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccgcgctttcatcactggcgtctccggccccgtcctgaccgacggggagcgc
gcatttttgcgcgaggaacagccctggggcttcatcctgttcaagcgcaatgttgagacg
ccgctgcaagttgctgcgttaattgacgatttgcgtgcgactgtgggtcgaccgaatgcc
ccggtcctgatcgatcaggaaggcgggcgggtccagcggctcgggccgccgcattgggca
cgctatccggccggggcagtgttcggggcgctgtatgaccggaacccggagcagggcctg
cgcgcggcatggctctcctcgcgcctcatcgcgtccgatctggcggggctcggcatcagc
gtcgattgtctaccgctcgccgacctgccggtcgagggggccgatgccgtgatcggcgat
cgagcctatggcaccacgccggacaaggtcgtggcgctggcgcgagccgtggcgaatggc
ctgcaggacggtggtattataccggtcttgaaacatatccccggccacggacgggccacc
gccgacagccatttgcggctgccgaccgtcgatacgccgcgcgcggaactggagcgcacc
gatttcgtgccgttcacgcagctcgcggatctgccgatggcgatgaccgcacatgttgtg
tttagcggcctcgatgccgcccaaccggcgaccacttctgcgacaatcatttctcaagtg
attcgcggcgcgatgaatttccaaggtttgctgatgagcgatgacgtctcgatgaatgcg
ctgagcggcacgctggccgagcgcacgcgggcgagcctcaaagcgggttgcgacgtggcg
cttcattgcaatggcaagatggacgagatgcgcgcggtggcgagcgaaacgccggaactg
gccggcgaggcgttgaagcgcgccgagcgggcgctggccgcccgcaaggcgccgcagccg
ttcgaccgcgaggccggccgcgcggagcttgatgaactgatcgcacaggcggggatcgca
tga

DBGET integrated database retrieval system