KEGG   Oligotropha carboxidovorans OM4: OCA4_c17610Help
Entry
OCA4_c17610       CDS       T01967                                 

Gene name
nagZ
Definition
(RefSeq) beta-hexosaminidase NagZ (EC:3.2.1.52)
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OCA4_c17610 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    OCA4_c17610 (nagZ)
Enzymes [BR:oco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     OCA4_c17610 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1910398..1911420
Genome map
AA seq 340 aa AA seqDB search
MAVRAFITGVSGPVLTDGERAFLREEQPWGFILFKRNVETPLQVAALIDDLRATVGRPNA
PVLIDQEGGRVQRLGPPHWARYPAGAVFGALYDRNPEQGLRAAWLSSRLIASDLAGLGIS
VDCLPLADLPVEGADAVIGDRAYGTTPDKVVALARAVANGLQDGGIIPVLKHIPGHGRAT
ADSHLRLPTVDTPRAELERTDFVPFTQLADLPMAMTAHVVFSGLDAAQPATTSATIISQV
IRGAMNFQGLLMSDDVSMNALSGTLAERTRASLKAGCDVALHCNGKMDEMRAVASETPEL
AGEALKRAERALAARKAPQPFDREAGRAELDELIAQAGIA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccgcgctttcatcactggcgtctccggccccgtcctgaccgacggggagcgc
gcatttttgcgcgaggaacagccctggggcttcatcctgttcaagcgcaatgttgagacg
ccgctgcaagttgctgcgttaattgacgatttgcgtgcgactgtgggtcgaccgaatgcc
ccggtcctgatcgatcaggaaggcgggcgggtccagcggctcgggccgccgcattgggca
cgctatccggccggggcagtgttcggggcgctgtatgaccggaacccggagcagggcctg
cgcgcggcatggctctcctcgcgcctcatcgcgtccgatctggcggggctcggcatcagc
gtcgattgtctaccgctcgccgacctgccggtcgagggggccgatgccgtgatcggcgat
cgagcctatggcaccacgccggacaaggtcgtggcgctggcgcgagccgtggcgaatggc
ctgcaggacggtggtattataccggtcttgaaacatatccccggccacggacgggccacc
gccgacagccatttgcggctgccgaccgtcgatacgccgcgcgcggaactggagcgcacc
gatttcgtgccgttcacgcagctcgcggatctgccgatggcgatgaccgcacatgttgtg
tttagcggcctcgatgccgcccaaccggcgaccacttctgcgacaatcatttctcaagtg
attcgcggcgcgatgaatttccaaggtttgctgatgagcgatgacgtctcgatgaatgcg
ctgagcggcacgctggccgagcgcacgcgggcgagcctcaaagcgggttgcgacgtggcg
cttcattgcaatggcaagatggacgagatgcgcgcggtggcgagcgaaacgccggaactg
gccggcgaggcgttgaagcgcgccgagcgggcgctggccgcccgcaaggcgccgcagccg
ttcgaccgcgaggccggccgcgcggagcttgatgaactgatcgcacaggcggggatcgca
tga

DBGET integrated database retrieval system