KEGG   Oligotropha carboxidovorans OM4: OCA4_c19180Help
Entry
OCA4_c19180       CDS       T01967                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
oco  Oligotropha carboxidovorans OM4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2070219..2071319)
Genome map
AA seq 366 aa AA seqDB search
MQHITRRDMIATCAGATVALLRGTESRSSIGESLGDAAASKNVMFGAAAAEAIDHDIGYR
DLYISQARLITTDTALKMGTVASRPGVKRFEPADKLLQFCTTNRIGLRGHCVIWNEWVPQ
WVRNMALAERRSFFDGYIEDVVGRYVGKLQSWDIVNEPFWPGHKAPGGYRLGPWYDAFGT
DYVRRAFERAGAVDKATKFVLNEAQTERDDPLGLAVREGLLKLVKELKDSGVRLDVVGLQ
GHLQPKYKHDPVRFADFVHKLSELGVDIYITEFDVRDDTFPDDIRARDELVAKTAEAFLD
NVLQISAVKAVIAWELADQYSFYTDLAKKKDPSAARLPRPLPYDSNLQKKPLWFAMQRAF
TNARRA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacatcacgcgacgcgatatgatcgcaacatgcgctggcgcgacagttgctttg
ttgcgcgggacagaatcacgatcgtcgattggcgagagtcttggtgatgcagctgcaagc
aagaatgtgatgttcggcgccgctgcagcggaagcaatcgatcacgatatcggctatcgc
gacctctacatctctcaggcacggctcatcacgacagatactgccttgaagatgggcact
gttgcatcacggccgggcgtgaagcgcttcgagcccgcggacaagctgttgcaattttgc
acgacgaaccggatcggtctgcgaggtcactgcgtcatctggaacgagtgggttccgcaa
tgggtccgcaacatggcgcttgccgagcggcgatcgttcttcgatggctacatcgaagac
gtcgtcggccgttatgtcggcaagctgcaatcatgggacattgtgaatgagccgttctgg
ccggggcacaaggcgccgggcggatacaggttgggcccatggtacgatgcattcggaacg
gattatgtccgccgtgctttcgagcgggcaggcgctgtcgacaaggctacgaaattcgtt
cttaacgaagcgcagacggaacgcgatgatccactcggactcgcggtgcgagaagggctc
ctcaaactggtcaaggagttgaaggattccggtgttcgtctggacgtcgttgggctgcag
gggcatctgcaaccgaaatacaagcacgatcccgtgcgatttgccgatttcgttcacaag
ctcagcgagcttggtgtcgacatctacatcacggaattcgatgtacgggacgatacgttt
ccggatgatatccgtgctcgcgacgagctggtggcaaagactgcggaagcgtttctcgac
aatgtgctgcagatctcggcggtgaaggcggtgatcgcctgggagcttgccgatcaatat
tcgttctacaccgatctcgccaagaagaaggacccgtccgccgcgcggctgccgcgcccg
ctgccctacgattcgaatctgcagaagaagccgctgtggttcgcgatgcagcgtgccttc
accaacgcacgccgggcatga

DBGET integrated database retrieval system