KEGG   Oligotropha carboxidovorans OM4: OCA4_c19420Help
Entry
OCA4_c19420       CDS       T01967                                 

Definition
putative protein-L-isoaspartate
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
oco  Oligotropha carboxidovorans OM4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2097929..2098588)
Genome map
AA seq 219 aa AA seqDB search
MPDALTSRWNMVDSQVRTADVTDLRLIEAMRATPREAFLPESQKALAYLDRDIALDGEDN
VYLIKPMVLGRLLQAADIEPTDRVLVTGGAAGYAAALAGRLGAEVVAVCANDKVAAASRS
ALEASGLSNITVTAGEAGQGDAARGPYDVIVLHGATEVVPQALYDQIKPGGRLVGVFAQS
VPSRATLVTRSEADFGARTLFDAAAPVLPGLKRLPGFTF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgctctgacttcccgctggaacatggtcgattcccaggttcgcaccgccgat
gtcacggatctgcgcctgatcgaggccatgcgggcgaccccgcgcgaggcatttcttccc
gagagccagaaggcgcttgcctatctcgatcgcgacatcgccctcgacggtgaggacaat
gtttatctcatcaagccgatggtgctcggccggctgctgcaggctgccgatatcgagccg
accgatcgggttctggtgacaggcggcgcagccggttatgcggcagcgctggcgggtcgt
ctcggggctgaggtcgtcgcggtctgtgccaatgacaaggtcgccgcggcaagccgctcg
gcgctcgaggctagcggcctctccaatatcacggtcacggcgggcgaggccgggcagggc
gatgctgccagggggccttacgacgtcatcgtgctccatggcgcgaccgaggtggttccg
caggccctctatgaccagatcaagcccggcggacgcctcgtcggcgtgttcgcgcaatct
gtgccctcgcgcgccaccctcgtgacccgctcggaggcagattttggcgcccggaccctg
ttcgacgccgctgcacccgttcttcccggccttaagcggttgccgggctttacattttga

DBGET integrated database retrieval system