KEGG   Oligotropha carboxidovorans OM4: OCA4_c20190Help
Entry
OCA4_c20190       CDS       T01967                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
oco  Oligotropha carboxidovorans OM4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2189660..2190727
Genome map
AA seq 355 aa AA seqDB search
MISLLEEHERTLAFAEVALGQIKSLRQSAIPRNYEIWYVYATGYNIELNKVINETLQHNG
RLTEADLEQIHETYLSPTRMTDRIDKVGSRVINEIDDVMSLITDAVGMTGSFSEDLDSAS
KRLVKAKDKAQINLIVHALLQSTREMSLTNKALEARLATSRLEIASLQDSLEAIRTESLT
DPLTSLGNRKYFDRALESAVEHASHHDEPLSLLMVDIDHFKSFNDNYGHLTGDQVLRLVA
LALKANIKGQDLTARYGGEEFVVILPNTSMRQALAVADNIRRAVMSKQLKKKSTGEILGR
VTISAGVSTFRPGDDAPALIDRADACLYAAKRHGRNRVICEADPEFTPNVRIQVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagtcttcttgaagaacacgagcgcaccctcgcgttcgccgaagtggcgttgggc
cagatcaagtccctgcgccagagtgcgatccctcgcaattacgaaatctggtacgtctac
gcgaccggctacaacatcgagctcaacaaggtcatcaacgagacgttgcagcacaacggc
cggctgaccgaggccgatctcgaacagatccacgaaacctatctgtcgccgacccgaatg
accgaccgcatcgacaaggtcggatcacgcgtcatcaacgagatcgacgacgtgatgagt
ctcatcaccgacgcggtcggtatgacgggttctttcagcgaggacctcgacagcgcaagc
aagcgtctcgtcaaggcgaaggacaaggcgcagatcaatctgatcgttcacgcgcttctt
caatcgacgcgggagatgagcctcaccaacaaggcgctggaggcgcggctcgccacgtca
cgcctcgagatcgccagcctgcaggacagccttgaagcgatccgcaccgagagcctgacc
gaccctctcacgtctctcggcaatcgcaaatatttcgatcgcgcgctggaatccgcggtg
gagcacgcaagccatcatgacgagccgctgtcgctgctgatggtcgacatcgatcacttc
aagtcgttcaacgacaattacggccacctcaccggcgaccaggtgcttcgcctggtggcg
ctcgcattgaaagccaacatcaagggtcaggacctgaccgcgcgctatggcggcgaggag
ttcgtggtcatcttaccgaacacctcgatgcgtcaggctttggctgttgccgacaacatc
cgccgcgccgtgatgtcaaagcagctcaagaagaagtcgaccggcgaaatcctcggtcgc
gtcacaatctccgccggcgtttcgaccttccggcccggcgacgacgcccccgctctgatc
gaccgcgccgacgcctgcctctatgccgccaagcggcacggccgcaatcgcgtgatctgc
gaagcagaccccgaattcacaccgaatgtccggattcaggtggcctga

DBGET integrated database retrieval system