KEGG   Oligotropha carboxidovorans OM4: OCA4_c21620Help
Entry
OCA4_c21620       CDS       T01967                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase HemB (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCA4_c21620 (hemB)
Enzymes [BR:oco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     OCA4_c21620 (hemB)
Exosome [BR:oco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCA4_c21620 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2350585..2351658
Genome map
AA seq 357 aa AA seqDB search
MAIKFGRPIEARDTAPSFTSGTDASPAALHLTTRMRRNRKSEWARRLVRENVLTTDDLIW
PLFAADGDNRREAVASMPGVERLSVDQCVRDAERAAKLDIPCIALFPYTDPALRDPQGSE
ALNADNLVCRTVRAVKKEFPDLGVLCDVALDPFTSHGHDGLLRDDGVIMNDETVAVLARQ
ALVQAEAGCDVIAPSDMMDGRIGAIRDALDAAGFGDVQIMAYAAKYASAFYGPFRDAVGS
AKALTGDKRTYQMDPANSDEALREVELDIAEGADMVMVKPGLPYLDILRRVKDTFAMPTF
AYQVSGEYAMLMAAANNGWLDGERAMMESLLAFKRAGADGVLTYFAPRAAEKLRTRG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaattcggacgaccgatcgaagcccgcgacactgcgccctctttcacctcc
ggcacagacgcctcgcccgcagcgctgcatctcaccacgcggatgcgccgcaaccgcaag
agcgaatgggcgcgccggctcgtgcgcgaaaatgtgctgacgacggacgatctgatctgg
ccgctgtttgccgcagatggcgacaacaggcgcgaggcggttgcctcgatgccgggcgtg
gaacggctcagcgtcgatcaatgcgtccgcgatgcggagcgcgcggccaagctcgacatc
ccgtgcattgccctgttcccctacactgatcctgccttgcgcgatccgcagggttccgag
gcgctgaacgcggacaatctggtgtgccggactgttcgcgccgtcaagaaagagtttccc
gatctcggcgtgctgtgcgacgtggcactcgatccgttcaccagccatggccatgacggt
ttgttgcgcgacgatggcgtcatcatgaacgacgagacggtcgccgtgcttgcgcgtcag
gcgctggtgcaggcggaagccggctgcgacgtcatcgcaccttccgacatgatggacggc
cgtatcggcgcgatccgcgatgcgctcgacgctgcgggattcggcgatgtgcagatcatg
gcctatgcggcgaaatacgcctccgccttctacggcccgttccgcgatgcggtcggctcc
gcgaaggcgctcaccggcgacaagcgcacctatcagatggacccggccaattccgacgaa
gcgctgcgcgaggtcgaactcgatatcgccgagggcgcggacatggtgatggtgaagccg
ggcctcccctatctcgatatcctgcggcgagtgaaggacaccttcgcgatgccgaccttc
gcctatcaggtgtccggcgagtacgcgatgctgatggcggcggcgaacaatggctggctc
gacggcgaacgcgcgatgatggaaagcctgctcgcgttcaagcgcgccggtgctgacggc
gttctcacctacttcgcgccgcgagcggccgagaagctgcgcaccaggggctaa

DBGET integrated database retrieval system