KEGG   Oligotropha carboxidovorans OM4: OCA4_c22200Help
Entry
OCA4_c22200       CDS       T01967                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase PyrB (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:oco00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:oco00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2409683..2410636
Genome map
AA seq 317 aa AA seqDB search
MTSAPKSSFVLGHRHLLGIEGLSAADITGLLDLAGEYVELNRQVDKKRSVLRGRTQVNLF
FEASTRTQSSFEIAGKRLGADVMNMSVSSSSMRKGETLMDTAVTLNAMHPDILVVRHHAS
GAVELLARKVDGSVVNAGDGAHEHPTQALLDALTIRRNKGRLEGLLIAICGDVLHSRVAR
SNIILLNLMGARVRVVGPSTLLPPGIERMGVEVAHDMREGLDGADIVMMLRLQRERMSGS
FVPSSSEYFQFFGLDQKKLSYAKPDALVMHPGPMNRGVEIDSIVADGAQSLVREQVEMGV
AVRMAVLEALARNLPNA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgcaccaaaatcgagtttcgtcctcgggcaccggcatctgctgggcatcgaa
ggcctttccgccgccgatatcaccggccttctcgacctcgccggcgaatatgtcgaactg
aaccgccaggtggacaagaagcgcagcgtgctgcgcggacgcacccaggtaaacctgttc
ttcgaggcatccacccgcacccagtcctccttcgagatcgccggcaagcggctcggggcg
gacgtcatgaacatgtccgtctcctcctcctcgatgcgcaagggcgagacgctgatggac
acggccgtgacgctgaacgcgatgcatcccgacattctcgtggtgcgccatcacgcgtcc
ggcgcggtggagttgcttgcgcgcaaggtcgacggctccgtcgtcaacgcaggcgacggc
gcgcatgagcacccgacgcaggcgctgctcgatgcgctcaccatccgccgcaacaagggc
cggctcgaagggttgctcatcgcaatctgcggcgatgtcctgcactcgcgcgtcgcccgc
tccaacatcatcctgctgaacctgatgggcgcacgggtgcgcgtcgtcggtccctcgacg
ctactgccgcccggcatcgagcgcatgggcgtcgaagtcgcccacgacatgcgcgaagga
ttggacggcgccgacatcgtgatgatgctgcggctgcaacgcgagcggatgagtggctcg
ttcgtgccgtcgagctctgaatatttccagttcttcggcctcgaccagaagaagctgtcc
tatgccaagcccgatgcgctggtgatgcatccgggcccgatgaatcgcggggtcgagatc
gactccatcgtcgccgacggcgcgcagtctctggtccgcgagcaagtcgaaatgggagtg
gcggtgcgcatggcggtgctcgaagcacttgcccgcaacctgccgaatgcgtga

DBGET integrated database retrieval system