KEGG   Oligotropha carboxidovorans OM4: OCA4_c26220Help
Entry
OCA4_c26220       CDS       T01967                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCA4_c26220 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCA4_c26220 (glk)
   00052 Galactose metabolism
    OCA4_c26220 (glk)
   00500 Starch and sucrose metabolism
    OCA4_c26220 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    OCA4_c26220 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OCA4_c26220 (glk)
   00524 Butirosin and neomycin biosynthesis
    OCA4_c26220 (glk)
Enzymes [BR:oco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     OCA4_c26220 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2783905..2784900)
Genome map
AA seq 331 aa AA seqDB search
MTAANRARSDDLGLDDLRIIGDIGGTHARFALARHGAYTHLQRVEVSRYDSLLEAMTDYL
ATLPPDFKPTVAVIDVAGPVRGDAVKMTNLDWSFSAEAMRRSLGLTAFRVLNDFAAAASS
IPYLPQTDCFPIGPDVPNASGPIGVVGPGTGLGVGALVPHGAQWTLVPGEGGHVSLPAST
GMEDRILAILRRRFGHVSAERALSGAGLVNLYEAVCEIEGVAAELLAPSDVTERAIKGSD
PRCVKAFAHFCELLGTIASDLALTLGANGGIYIAGGILPRFKEAFAASGFRARFEDKGRF
RDWLRTVPTRLILEESPALTGLANVPVGADY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggcgaaccgcgcaagatccgatgatttggggctcgatgatctgcggatcatc
ggtgatatcggcggaacgcatgcgcgcttcgcgctcgcccggcacggtgcctacacgcat
ctgcagcgcgtcgaggtgagccgctacgactctctgcttgaggcgatgaccgattatctc
gcgacgctgccgcctgacttcaagccgacagtcgcggtgatcgatgtggcggggccggtg
cgtggcgacgcggtgaagatgaccaatctcgactggtcgttctcggcagaggcgatgcgg
cgcagcctcgggttgacggcgtttcgcgtgctcaacgatttcgccgcggcggcctcgtcc
attccctatctgccgcagaccgattgtttccccatcggaccggatgtgccgaacgcgagc
ggcccgattggcgtggtcggtcccggtaccgggcttggtgtcggcgcactggtgccgcat
ggcgcgcagtggaccctggtgccgggagagggcgggcatgtcagcttgccggcttcgacc
gggatggaggatcgcatcctcgccattctgcgccggcggttcggccatgtctcggccgag
cgcgcgctgtcgggagcggggctcgtcaatctctacgaggcggtgtgcgagatcgagggc
gttgccgccgagctacttgcgccatccgatgtcacggagcgtgccatcaagggcagcgat
ccgcgttgcgtgaaagcgttcgcgcatttctgcgaactgttgggcacgattgcgagcgac
cttgcgctgacgcttggtgcgaacggcggcatctatatcgcgggcggcatcctgccgcgt
ttcaaggaggcgtttgcggcctccggcttccgcgcgcggttcgaggacaagggccgcttc
cgcgactggctgcgcacggtgccgacgcggcttatccttgaagagtcgcccgcgctgacc
ggcctcgcgaatgtgccggtgggggcggattactag

DBGET integrated database retrieval system