KEGG   Oligotropha carboxidovorans OM4: OCA4_c27450Help
Entry
OCA4_c27450       CDS       T01967                                 

Gene name
fadA2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00071  Fatty acid degradation
oco00072  Synthesis and degradation of ketone bodies
oco00280  Valine, leucine and isoleucine degradation
oco00310  Lysine degradation
oco00362  Benzoate degradation
oco00380  Tryptophan metabolism
oco00620  Pyruvate metabolism
oco00630  Glyoxylate and dicarboxylate metabolism
oco00640  Propanoate metabolism
oco00650  Butanoate metabolism
oco00900  Terpenoid backbone biosynthesis
oco01100  Metabolic pathways
oco01110  Biosynthesis of secondary metabolites
oco01120  Microbial metabolism in diverse environments
oco01130  Biosynthesis of antibiotics
oco01200  Carbon metabolism
oco01212  Fatty acid metabolism
oco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCA4_c27450 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    OCA4_c27450 (fadA2)
   00640 Propanoate metabolism
    OCA4_c27450 (fadA2)
   00650 Butanoate metabolism
    OCA4_c27450 (fadA2)
  Lipid metabolism
   00071 Fatty acid degradation
    OCA4_c27450 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    OCA4_c27450 (fadA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCA4_c27450 (fadA2)
   00310 Lysine degradation
    OCA4_c27450 (fadA2)
   00380 Tryptophan metabolism
    OCA4_c27450 (fadA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCA4_c27450 (fadA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCA4_c27450 (fadA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCA4_c27450 (fadA2)
Enzymes [BR:oco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCA4_c27450 (fadA2)
Exosome [BR:oco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCA4_c27450 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEI03863
Position
complement(2928800..2930083)
Genome map
AA seq 427 aa AA seqDB search
MSRPVYIIDGSRTPFLKAQGGPGPFTPVDLAVQAGRPLLARQPFKSSDFDQVILGCVNVI
ADEVNPARVAALRLGMGEDMVAFGVQINCGSGMQSIDTAYRYIQAGQADMILAGGAEALS
YSPLVFPQSGVRWFAGLATARTTLAKLAAFFKLRPSYFKPIIGLERGLTDPVTDLNMGQT
AEVIAHLMGITREQADAYAVESHQRLANAQAQGFLKGEVETAFDRKGKYYDHDDGVRPDS
SMEKLAKLKPAFERPWGQVTPGNSSQITDGACWTILASEDAVKKYGLKPKARIIDSAWSG
LDPTVMGFGPVLSSNRLLKRNNMTIHDIETWEINEAFASQVLACLAAWKDDKFCREVLGL
DGAAGEIDRAKLNVDGGAISLGHPVGTSGNRIVLHLVNAMHRLGTRRGVATECIGGGLGG
AMLIETV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcctgtctatattatcgatggtagccgcacgccgtttctgaaggcgcaaggc
ggtccgggtccgttcacgccggtcgatcttgccgtgcaggcgggccgtccgctgctggcg
cgacagccgttcaaatcttccgacttcgatcaggtcattctcggctgcgtcaacgtgatt
gccgatgaagtcaatcccgcccgtgtcgccgcgctgcgcctcggcatgggcgaggacatg
gtcgctttcggcgtgcagatcaactgcggctccggcatgcagtcgatcgacaccgcctat
cgctacattcaggccgggcaggcggacatgatccttgccggcggtgcggaggcgttgagc
tattcgccgctggtgtttccgcaatctggcgtgcgctggttcgccggccttgcgacggcg
cgcaccacgcttgcgaagctcgcggctttcttcaagctgcgcccgtcttacttcaagccg
atcatcgggctcgaacgcggattgacggaccccgtcaccgacctcaacatggggcagacg
gcggaggtgatcgcgcatctgatgggcatcacgcgcgaacaggctgacgcctatgccgtg
gaaagccatcaacggctggcgaacgcacaggcgcaaggcttcctcaagggcgaagtcgaa
accgccttcgaccgcaagggcaagtattacgatcacgacgacggcgtgcgccccgattcc
tcgatggagaagcttgcgaagctcaagcccgctttcgagcggccatgggggcaggtgacg
ccgggcaattcctcgcagattactgacggcgcatgctggaccattctggcgtcggaagat
gcggtcaagaaatacgggctgaagccaaaagcccgcatcattgatagcgcatggtcggga
ctcgatccgacggtgatgggctttggcccggtactgtcgtcgaaccggcttctcaagcgc
aacaatatgacgatccacgatatcgagacgtgggagatcaacgaagcgttcgcttcgcag
gtgctggcctgccttgctgcgtggaaggacgacaagttctgtcgcgaagttctggggctt
gatggcgcggccggtgagatcgaccgagccaaactcaatgtcgatggcggcgcgatcagc
ctcggccacccggttggcaccagcggaaatcgtatcgtgttgcatcttgtcaatgcgatg
catcgcctcggcaccaggcgcggcgttgcgacggaatgtatcggcggcggcctcggcggc
gccatgttgatcgagacggtttag

DBGET integrated database retrieval system