KEGG   Oligotropha carboxidovorans OM4: OCA4_c29700Help
Entry
OCA4_c29700       CDS       T01967                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OCA4_c29700 (galU)
   00052 Galactose metabolism
    OCA4_c29700 (galU)
   00500 Starch and sucrose metabolism
    OCA4_c29700 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    OCA4_c29700 (galU)
Enzymes [BR:oco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OCA4_c29700 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3161494..3162420
Genome map
AA seq 308 aa AA seqDB search
MPSKTSPSKTSPSKRSRLMKIRKAVFPVAGLGTRFLPATKAMPKEMLTVVDRPLIQHVVD
EALEAGIEHLVFVTGRNKGVIEDHFDRPYELEDTLKERNKLKEMDILERDQPEAGATSFT
RQQAPLGLGHAVWCARDIIGNEPFAVLLPDVLVKHKPSGLKQMIDAAAAAGASSANIIAV
EEVPMEHVHMYGVVGVGPSKGDLFELNGMVEKPKKEVAPSNLSITGRYILQPEIFNILET
QERGAGGEIQLTDAMLALAGKQPFYGFKFKGKSYDCGSKSGFLAANIAYAMDREDLRGDL
LSEMKKYV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgccctccaagacctcgccatccaagacctcgccatccaagagaagccgcctcatgaaa
atccgcaaagccgtatttcccgtcgccggcctcggcacccgtttccttcccgccaccaag
gcgatgccgaaggagatgctgaccgtggtggaccgcccgctgattcagcatgtggtggac
gaagcgctggaggccggcatcgagcacctcgtgttcgtcaccgggcgcaacaagggcgtg
atcgaggatcacttcgaccgcccctacgagctcgaggacacgctgaaggagcgcaacaag
ctcaaggaaatggacatcctcgagcgcgaccagccggaagccggcgcgacctcgttcacg
cgccagcaggcgccgctcggcctcggccatgcggtgtggtgcgcgcgcgacatcatcggc
aacgagccgttcgccgtgctgctgcccgacgtgctggtgaagcacaagccgagcggcctg
aagcagatgatcgatgcggccgccgccgcgggcgcctccagcgccaacatcatcgcggtg
gaagaagtgccgatggagcacgtccacatgtacggcgtcgtcggcgtcggcccgtcgaag
ggcgacctgttcgaactgaacggcatggtcgagaagccgaagaaggaagtcgcgccctcg
aacctctcgatcaccgggcgctacatcctgcagccggagatcttcaatatcctcgagacg
caggagcgcggcgcgggcggcgaaatccagcttaccgacgcgatgctcgcgcttgcggga
aagcagccgttctacggattcaagttcaagggcaagagctacgactgcggatcgaagtca
ggatttttggccgccaacatcgcctacgccatggaccgcgaagacctgcgcggcgatttg
ctcagcgagatgaagaagtatgtgtga

DBGET integrated database retrieval system