KEGG   Oligotropha carboxidovorans OM4: OCA4_c31680Help
Entry
OCA4_c31680       CDS       T01967                                 

Gene name
hisD
Definition
histidinol dehydrogenase HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:oco01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:oco00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3349172..3350467)
Genome map
AA seq 431 aa AA seqDB search
MPIRLDDRSPDFTARFAAFLSMKREVARDIDMAARAIVEDVAARGDAALIEATAKFDRLS
LKPETLRVSADDIAAATAACDPKTVDALKLARDRIEVYHRRQLPKDERFTDPLGVELGWR
WSAVEAVGLYVPGGTAAYPSSVLMNAVPAKVAGVSRIVMVVPAPDGKLNPLVLAAASLAG
ITEVYRVGGAQAVAALAYGTATIKPVAKIVGPGNAYVAAAKRIVFGKVGIDMIAGPSEVL
VMADHTANPDWIAADLLAQAEHDVNAQSILLTDDEELAGHVERAVEAQLATLPRAAIARP
SWNDFGAIIVVKSMEAALPLADAIAAEHLEIMTADAEALAARVRNAGAIFIGAYTPEAIG
DYVGGSNHVLPTARSARFSSGLNVLDFMKRTSILKCGAEQLRALGPAAMTLGTAEGLDAH
ARSVGVRLNLP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccgatccgccttgacgaccgtagtcccgatttcaccgcgcgttttgccgccttcctg
tcgatgaagcgcgaggttgcgcgcgatattgacatggccgcccgtgcaattgtcgaggat
gtggccgcgcgcggcgacgcggcgctgatcgaggccaccgcgaaattcgaccgcttgtcg
ctgaaacccgagacgctgcgggtgagcgccgatgacatcgccgcggcgacggcagcctgc
gatccgaaaaccgtagacgcactcaagctcgcgcgcgaccggatcgaggtctatcaccgc
cgccagctgccgaaggatgaacgcttcaccgatccgctcggcgtcgaactcggctggcgc
tggagcgcggtcgaggcggtcgggctttatgtccccggcggcaccgcggcctatccgtcg
tcggtgctgatgaacgccgtccccgccaaggtcgcaggcgtctcgcgcatcgtgatggtg
gtgcccgcgccggacggcaagctcaacccgctggtgctggcggcggcctcgctcgccggc
atcaccgaagtctatcgtgtcggcggtgcgcaggccgtggcggcgctcgcctatggtacg
gcgacgatcaaaccggtggcgaagatcgtcggtcccggcaacgcctatgtcgccgccgcc
aagcgcatcgttttcggcaaggtcggcatcgacatgatcgcgggtccctccgaagtgctg
gtgatggcggaccacaccgccaatcccgactggatcgcggccgacctgctggcgcaggct
gagcatgacgtcaacgcgcagtcgatcctgctcactgatgatgaagaactcgccggccat
gtcgagcgtgccgtcgaggcgcagcttgcgacgctgccgcgtgcagccattgctcgcccg
tcgtggaatgatttcggcgcgatcatcgtggtgaaatcgatggaagcagcgctgccgctt
gccgatgcgattgccgccgagcatctcgagatcatgacggcagatgcggaagcgctcgcc
gcgcgcgtgcgcaatgccggtgcgatcttcatcggcgcgtacacgccggaggcgatcggc
gattacgtcggcggctccaaccatgtgctgccgacggcgcgctcggcgcggttttcttcc
ggcctcaacgtgctcgatttcatgaagcgcacgtcgatcctcaaatgcggtgcggagcag
ttgcgcgcgctcggccccgccgcgatgacgctcggcaccgccgagggcctcgatgcgcat
gcgcgttccgttggtgtgcggctgaatctgccatga

DBGET integrated database retrieval system