KEGG   Oligotropha carboxidovorans OM4: OCA4_c31890Help
Entry
OCA4_c31890       CDS       T01967                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:oco00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3369484..3370284)
Genome map
AA seq 266 aa AA seqDB search
MDVKTDDKLNLRAKEYFDERATKEMAEHLKGAQRSPKEKLAYACRILAMTEQEAGLAGQI
SLRSERPNAYWTLRFGLGFDEATPDDFIEVDRDLNTLTGTGMPNPATRFHLWVYEARPDV
QSMIHTHSPWASALAAARQPLVISQMDMTPLHDDCAFLGDWPGVPIADQEGVLISAALGS
KRAIILAHHGYLTAGCSIEEATYLSVYLERAARMQIRARVFGPLTPVDPELAKEAHDYLL
KPSIVNATFDYWCRQTHQANLAPTPR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgaagacagacgacaagctcaacctgcgcgccaaggaatatttcgacgagcgc
gccaccaaggaaatggcggagcatctgaaaggcgcccagcgcagcccgaaggaaaagctc
gcctatgcctgccgcatcctggcgatgactgaacaggaagcgggcctcgccggccagatc
agcctgcgctccgagcggccgaatgcctactggacgctacgctttggccttggcttcgac
gaagcgacgccggacgatttcatcgaggtcgaccgcgacctgaacacgctgaccggcact
ggcatgccgaaccctgcgacccgttttcacctctgggtatatgaagcgcgcccggatgtg
cagtcgatgatccacactcactcgccgtgggcctcggcgctcgccgccgcgcgccagccg
ctggtgatctcgcagatggacatgacgccgctgcatgacgactgcgcgttcctcggcgac
tggccgggcgtgccgatcgccgatcaggagggtgtgctgatttccgcggcgctcggctcc
aagcgcgcgatcatccttgctcaccatggctatctgactgcgggctgctcgatcgaggaa
gcgacctatctgtcggtctatctcgaacgtgccgcgcgcatgcagattcgcgcccgcgtg
ttcggcccgctgacgccggtcgatcccgagctcgccaaggaagcgcacgactatctgctc
aagccctcgatcgtgaacgccacgttcgattactggtgccggcagacgcatcaggcaaat
ctggcgccgaccccgcgctaa

DBGET integrated database retrieval system