KEGG   Oligotropha carboxidovorans OM4: OCA4_c32050Help
Entry
OCA4_c32050       CDS       T01967                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCA4_c32050 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCA4_c32050 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OCA4_c32050 (thrC)
Enzymes [BR:oco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OCA4_c32050 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3385687..3387102)
Genome map
AA seq 471 aa AA seqDB search
MTTYLSTRGEAPRLGFWDVMLTGLARDGGLYVPEVWPTLSHETISGFAGRPYWQVATDVI
RPFVAGEISDADLGRMTNEAYATFRHPAVVPLDQSGPNQFTLELFHGPTLAFKDVAMQLL
SRLMDHVLAKRGTRTTIVVATSGDTGGAAVEAFKDRANVDLFVLFPHGRISDVQRRMMTT
TGAANVHALAVEGTFDDCQAIVKALFNHHAFRDQVSLSGVNSINWARIVAQTVYYFTSAV
ALGAPARAIDFTVPTGNFGDIFAGYVAKRMGLPIGKLRVATNVNDILARTLQNGHYEVRE
VEATQSPSMDIQVSSNFERLMFEASGRDAALVRGLMASLAQSGRFALPTPVLNAIRRDFE
AGRADEAEVAATMRAAFREAGDLVDPHTSVALAVAERDSADSKTPNVVLSTAHPAKFPDA
VEAACGTRPSLPVWLDGLMSRKEHITVMKNDPAAVEAFVLSASRVVRQEVH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacctatctttccacgaggggcgaggccccgcggctcggcttttgggatgtgatg
ctgaccgggcttgcccgtgacggcggcctctatgtgccggaggtctggccgacgctctcg
catgagacgatctccggctttgccggtcgcccttattggcaggtcgcaaccgatgtaatc
cgtcccttcgttgcgggggagatttccgatgcggatctcggccgcatgaccaacgaagcc
tacgcgacgttccgccatcctgcggtggtgccgctcgaccagagcgggccgaaccagttc
acgctcgagctgtttcatgggccgacgctcgcgttcaaggacgtggcgatgcagcttctg
tcgcggctgatggaccatgtgctggcgaagcgtggcacgcgcaccaccatcgtggttgcg
acctccggcgacaccggcggtgcggccgtcgaggcattcaaggaccgcgcgaacgtcgac
ctgttcgtgctgtttccgcacggccgcatctctgacgtgcagcggcggatgatgacgacg
accggtgctgcgaacgttcatgcgctcgcggtcgaaggcacgttcgacgattgccaggcg
atcgtgaaggcgttgttcaaccatcatgcgtttcgcgatcaggtgtcgctgtccggcgtc
aactcgatcaactgggcgcggatcgttgcgcagaccgtatattacttcacctcggcagtg
gcgctcggcgcacccgcgcgcgcgatcgacttcacggtgccgaccggaaatttcggtgac
atcttcgcgggctatgtggcaaagcgcatgggcctgccgatcggcaagctgcgcgtcgcc
acgaacgtgaacgacattctcgcgcgcacgctgcagaatggccattacgaggtgcgtgaa
gtcgaggcaacgcagtcgccgtcgatggacattcaggtgtcgtcgaatttcgagcggctg
atgttcgaggcgagcgggcgcgatgcggcgctggtgcgcggcctgatggcctcgcttgcg
cagtccggccgctttgcgctgccgacgccggtgctcaacgccattcgccgcgactttgaa
gcggggcgcgccgacgaggcggaggtcgccgcgacgatgcgtgcagcgtttcgtgaggcg
ggcgatctggtcgatccacatacctcagtggcgcttgctgttgccgagcgcgacagcgcc
gattcgaaaacgccgaatgtggtgctctccaccgcgcatccggcaaaattccccgatgcg
gtcgaggctgcctgtggcacccgcccgagtctccctgtgtggctcgacggattgatgagc
cgcaaggagcacatcaccgtgatgaagaatgatcccgcggcagtcgaggctttcgtgcta
tcggcaagccgcgtcgtgagacaagaggttcactga

DBGET integrated database retrieval system