KEGG   Oligotropha carboxidovorans OM4: OCA4_c33410Help
Entry
OCA4_c33410       CDS       T01967                                 

Gene name
rfbC2
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase RfbC
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00521  Streptomycin biosynthesis
oco00523  Polyketide sugar unit biosynthesis
oco01130  Biosynthesis of antibiotics
Module
oco_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    OCA4_c33410 (rfbC2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OCA4_c33410 (rfbC2)
Enzymes [BR:oco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     OCA4_c33410 (rfbC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Peptidase_M1
Motif
Other DBs
NCBI-ProteinID: AEI04436
Position
3527597..3528142
Genome map
AA seq 181 aa AA seqDB search
MTAAAATLDGVVVIEPQVFTDARGYFFESFNAERFRERVARDVTFVQDNQSLSRKGVVRG
LHYQIAPKAQGKLVRALAGEIFDVAVDIRKGSKQFGQWFGTILSAENKKQLWVPEGYAHG
FQVLSETAEVLYKTTDFWSAAHERAIRWDDPTLAIDWPLKEGCIVSGKDGEAPLLADATL
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcagcggcaacactcgatggcgtcgtggtgatcgagccgcaggtattcacc
gacgcgcgtggttattttttcgagagcttcaacgccgagcgcttccgtgaacgcgtagcc
agagacgtgaccttcgtgcaggacaatcagtccctgtcgcgcaagggcgtggtgcgcggc
ctgcactatcagatcgcgccgaaggctcaaggcaagctggtgcgggcgctggcaggcgag
attttcgacgtcgccgtcgatatccggaaaggctcgaagcaattcggccaatggttcggc
accatcctcagcgcggaaaacaagaagcagctctgggtgccggaaggatatgcccacggc
tttcaggtgctgagcgagaccgccgaggtgctctacaagaccaccgacttctggtcggcc
gcgcatgagcgcgccatccgctgggacgacccgacgcttgcgatcgactggccgctcaag
gagggttgcatcgtgtcggggaaagacggcgaagcgccgcttcttgctgacgcgacgctg
ttctga

DBGET integrated database retrieval system