KEGG   Oligotropha carboxidovorans OM4: OCA4_c33410Help
Entry
OCA4_c33410       CDS       T01967                                 

Gene name
rfbC2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase RfbC (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:oco00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:oco00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3527597..3528142
Genome map
AA seq 181 aa AA seqDB search
MTAAAATLDGVVVIEPQVFTDARGYFFESFNAERFRERVARDVTFVQDNQSLSRKGVVRG
LHYQIAPKAQGKLVRALAGEIFDVAVDIRKGSKQFGQWFGTILSAENKKQLWVPEGYAHG
FQVLSETAEVLYKTTDFWSAAHERAIRWDDPTLAIDWPLKEGCIVSGKDGEAPLLADATL
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcagcggcaacactcgatggcgtcgtggtgatcgagccgcaggtattcacc
gacgcgcgtggttattttttcgagagcttcaacgccgagcgcttccgtgaacgcgtagcc
agagacgtgaccttcgtgcaggacaatcagtccctgtcgcgcaagggcgtggtgcgcggc
ctgcactatcagatcgcgccgaaggctcaaggcaagctggtgcgggcgctggcaggcgag
attttcgacgtcgccgtcgatatccggaaaggctcgaagcaattcggccaatggttcggc
accatcctcagcgcggaaaacaagaagcagctctgggtgccggaaggatatgcccacggc
tttcaggtgctgagcgagaccgccgaggtgctctacaagaccaccgacttctggtcggcc
gcgcatgagcgcgccatccgctgggacgacccgacgcttgcgatcgactggccgctcaag
gagggttgcatcgtgtcggggaaagacggcgaagcgccgcttcttgctgacgcgacgctg
ttctga

DBGET integrated database retrieval system